UBE2W (NM_018299) Human Tagged ORF Clone

SKU
RG204985
UBE2W (tGFP-tagged) - Human ubiquitin-conjugating enzyme E2W (putative) (UBE2W), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol UBE2W
Synonyms UBC-16; UBC16
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG204985 representing NM_018299
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCAATGCAGAAACGACTACAGAAAGAACTGTTGGCTTTGCAAAATGACCCACCTCCTGGAATGA
CCTTAAATGAGAAGAGTGTTCAAAATTCAATTACACAGTGGATTGTAGACATGGAAGGTGCACCAGGTAC
CTTATATGAAGGGGAAAAATTTCAACTTCTATTTAAATTTAGTAGTCGATATCCTTTTGACTCTCCTCAG
GTCATGTTTACTGGTGAAAATATTCCTGTTCATCCTCATGTTTATAGCAATGGTCATATCTGTTTATCCA
TTCTAACAGAAGACTGGTCCCCAGCGCTCTCAGTCCAATCAGTTTGTCTTAGCATTATTAGCATGCTTTC
CAGCTGCAAGGAAAAGAGACGACCACCGGATAATTCTTTTTATGTGCGAACATGTAACAAGAATCCAAAG
AAAACAAAATGGTGGTATCATGATGATACTTGT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204985 representing NM_018299
Red=Cloning site Green=Tags(s)

MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQ
VMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPK
KTKWWYHDDTC

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018299
ORF Size 453 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018299.6
RefSeq Size 4024 bp
RefSeq ORF 456 bp
Locus ID 55284
UniProt ID Q96B02
Cytogenetics 8q21.11
Domains UBCc
Protein Families Transcription Factors
Protein Pathways Ubiquitin mediated proteolysis
Summary This gene encodes a nuclear-localized ubiquitin-conjugating enzyme (E2) that, along with ubiquitin-activating (E1) and ligating (E3) enzymes, coordinates the addition of a ubiquitin moiety to existing proteins. The encoded protein promotes the ubiquitination of Fanconi anemia complementation group proteins and may be important in the repair of DNA damage. There is a pseudogene for this gene on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]
Write Your Own Review
You're reviewing:UBE2W (NM_018299) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204985 UBE2W (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2W (putative) (UBE2W), transcript variant 2 10 ug
$150.00
RC204985L1 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2W (putative) (UBE2W), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC204985L2 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2W (putative) (UBE2W), transcript variant 2, mGFP tagged 10 ug
$450.00
RC204985L3 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2W (putative) (UBE2W), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC204985L4 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2W (putative) (UBE2W), transcript variant 2, mGFP tagged 10 ug
$450.00
SC113604 UBE2W (untagged)-Human ubiquitin-conjugating enzyme E2W (putative) (UBE2W), transcript variant 2 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.