HSPC014 (POMP) (NM_015932) Human Tagged ORF Clone

SKU
RG204812
POMP (tGFP-tagged) - Human proteasome maturation protein (POMP)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HSPC014
Synonyms C13orf12; HSPC014; PNAS-110; PRAAS2; UMP1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG204812 representing NM_015932
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATGCCAGAGGACTTGGATCTGAGCTAAAGGACAGTATTCCAGTTACTGAACTTTCAGCAAGTGGAC
CTTTTGAAAGTCATGATCTTCTTCGGAAAGGTTTTTCTTGTGTGAAAAATGAACTTTTGCCTAGTCATCC
CCTTGAATTATCAGAAAAAAATTTCCAGCTCAACCAAGATAAAATGAATTTTTCCACACTGAGAAACATT
CAGGGTCTATTTGCTCCGCTAAAATTACAGATGGAATTCAAGGCAGTGCAGCAGGTTCAGCGTCTTCCAT
TTCTTTCAAGCTCAAATCTTTCACTGGATGTTTTGAGGGGTAATGATGAGACTATTGGATTTGAGGATAT
TCTTAATGATCCATCACAAAGCGAAGTCATGGGAGAGCCACACTTGATGGTGGAATATAAACTTGGTTTA
CTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204812 representing NM_015932
Red=Cloning site Green=Tags(s)

MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNI
QGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGL
L

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_015932
ORF Size 423 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_015932.6
RefSeq Size 1352 bp
RefSeq ORF 426 bp
Locus ID 51371
UniProt ID Q9Y244
Cytogenetics 13q12.3
Protein Pathways Proteasome
Summary The protein encoded by this gene is a molecular chaperone that binds 20S preproteasome components and is essential for 20S proteasome formation. The 20S proteasome is the proteolytically active component of the 26S proteasome complex. The encoded protein is degraded before the maturation of the 20S proteasome is complete. A variant in the 5' UTR of this gene has been associated with KLICK syndrome, a rare skin disorder.[provided by RefSeq, Aug 2010]
Write Your Own Review
You're reviewing:HSPC014 (POMP) (NM_015932) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204812 POMP (Myc-DDK-tagged)-Human proteasome maturation protein (POMP) 10 ug
$150.00
RC204812L1 Lenti ORF clone of Human proteasome maturation protein (POMP), Myc-DDK-tagged 10 ug
$450.00
RC204812L2 Lenti ORF clone of Human proteasome maturation protein (POMP), mGFP tagged 10 ug
$450.00
RC204812L3 Lenti ORF clone of Human proteasome maturation protein (POMP), Myc-DDK-tagged 10 ug
$450.00
RC204812L4 Lenti ORF clone of Human proteasome maturation protein (POMP), mGFP tagged 10 ug
$450.00
SC114530 POMP (untagged)-Human proteasome maturation protein (POMP) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.