Macrophage Inflammatory Protein 3 alpha (CCL20) (NM_004591) Human Tagged ORF Clone

SKU
RG204691
CCL20 (tGFP-tagged) - Human chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Macrophage Inflammatory Protein 3 alpha
Synonyms CKb4; Exodus; LARC; MIP-3-alpha; MIP-3a; MIP3A; SCYA20; ST38
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG204691 representing NM_004591
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGCTGTACCAAGAGTTTGCTCCTGGCTGCTTTGATGTCAGTGCTGCTACTCCACCTCTGCGGCGAAT
CAGAAGCAAGCAACTTTGACTGCTGTCTTGGATACACAGACCGTATTCTTCATCCTAAATTTATTGTGGG
CTTCACACGGCAGCTGGCCAATGAAGGCTGTGACATCAATGCTATCATCTTTCACACAAAGAAAAAGTTG
TCTGTGTGCGCAAATCCAAAACAGACTTGGGTGAAATATATTGTGCGTCTCCTCAGTAAAAAAGTCAAGA
ACATG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204691 representing NM_004591
Red=Cloning site Green=Tags(s)

MCCTKSLLLAALMSVLLLHLCGESEASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKL
SVCANPKQTWVKYIVRLLSKKVKNM

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004591
ORF Size 285 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004591.1, NP_004582.1
RefSeq Size 799 bp
RefSeq ORF 291 bp
Locus ID 6364
UniProt ID P78556
Cytogenetics 2q36.3
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction
Summary This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The protein encoded by this gene displays chemotactic activity for lymphocytes and can repress proliferation of myeloid progenitors. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]
Write Your Own Review
You're reviewing:Macrophage Inflammatory Protein 3 alpha (CCL20) (NM_004591) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204691 CCL20 (Myc-DDK-tagged)-Human chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1 10 ug
$150.00
RC204691L1 Lenti ORF clone of Human chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC204691L2 Lenti ORF clone of Human chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1, mGFP tagged 10 ug
$450.00
RC204691L3 Lenti ORF clone of Human chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC204691L4 Lenti ORF clone of Human chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1, mGFP tagged 10 ug
$450.00
SC122685 CCL20 (untagged)-Human chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.