LGALS14 (NM_020129) Human Tagged ORF Clone

SKU
RG204625
LGALS14 (tGFP-tagged) - Human lectin, galactoside-binding, soluble, 14 (LGALS14), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LGALS14
Synonyms CLC2; PPL13
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG204625 representing NM_020129
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCATCACTACCCGTACCATACACACTGCCTGTTTCCTTGCCTGTTGGTTCGTGCGTGATAATCACAG
GGACACCGATCCTCACTTTTGTCAAGGACCCACAGCTGGAGGTGAATTTCTACACTGGGATGGATGAGGA
CTCAGATATTGCTTTCCAATTCCGACTGCACTTTGGTCATCCTGCAATCATGAACAGTTGTGTGTTTGGC
ATATGGAGATATGAGGAGAAATGCTACTATTTACCCTTTGAAGATGGCAAACCATTTGAGCTGTGCATCT
ATGTGCGTCACAAGGAATACAAGGTAATGGTAAATGGCCAACGCATTTACAACTTTGCCCATCGATTCCC
GCCAGCATCTGTGAAGATGCTGCAAGTCTTCAGAGATATCTCCCTGACCAGAGTGCTTATCAGCGAT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204625 representing NM_020129
Red=Cloning site Green=Tags(s)

MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFG
IWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_020129
ORF Size 417 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020129.3
RefSeq Size 794 bp
RefSeq ORF 420 bp
Locus ID 56891
UniProt ID Q8TCE9
Cytogenetics 19q13.2
Domains Gal-bind_lectin
Protein Families Transmembrane
Summary This gene is predominantly expressed in placenta. The encoded protein belongs to the galectin (galaptin/S-lectin) family. The members of galectin family contain one or two carbohydrate recognition domains, which can bind beta-galactoside. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:LGALS14 (NM_020129) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204625 LGALS14 (Myc-DDK-tagged)-Human lectin, galactoside-binding, soluble, 14 (LGALS14), transcript variant 1 10 ug
$150.00
RC204625L3 Lenti ORF clone of Human lectin, galactoside-binding, soluble, 14 (LGALS14), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC204625L4 Lenti ORF clone of Human lectin, galactoside-binding, soluble, 14 (LGALS14), transcript variant 1, mGFP tagged 10 ug
$450.00
SC108741 LGALS14 (untagged)-Human lectin, galactoside-binding, soluble, 14 (LGALS14), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.