C1orf54 (NM_024579) Human Tagged ORF Clone

SKU
RG204611
C1orf54 (tGFP-tagged) - Human chromosome 1 open reading frame 54 (C1orf54)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol C1orf54
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG204611 representing NM_024579
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATGTCCTCTTTGTAGCCATCTTTGCTGTGCCACTTATCCTGGGACAAGAATATGAGGATGAAGAAA
GACTGGGAGAGGATGAATATTATCAGGTGGTCTATTATTATACAGTCACCCCCAGTTATGATGACTTTAG
TGCAGATTTCACCATTGATTACTCCATATTTGAGTCAGAGGACAGGCTGAACAGGTTGGATAAGGACATA
ACAGAAGCAATAGAGACTACCATTAGTCTTGAAACAGCACGTGCAGACCATCCGAAGCCTGTAACTGTGA
AACCAGTAACAACGGAACCTAGCCCAGATCTGAACGATGCCGTGTCCAGTTTGCGAAGTCCTATTCCCCT
CCTCCTGTCGTGTGCCTTTGTTCAGGTGGGGATGTATTTCATG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204611 representing NM_024579
Red=Cloning site Green=Tags(s)

MDVLFVAIFAVPLILGQEYEDEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESEDRLNRLDKDI
TEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSLRSPIPLLLSCAFVQVGMYFM

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_024579
ORF Size 393 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024579.1, NP_078855.1
RefSeq Size 519 bp
RefSeq ORF 396 bp
Locus ID 79630
UniProt ID Q8WWF1
Cytogenetics 1q21.2
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:C1orf54 (NM_024579) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204611 C1orf54 (Myc-DDK-tagged)-Human chromosome 1 open reading frame 54 (C1orf54) 10 ug
$150.00
RC204611L1 Lenti ORF clone of Human chromosome 1 open reading frame 54 (C1orf54), Myc-DDK-tagged 10 ug
$450.00
RC204611L2 Lenti ORF clone of Human chromosome 1 open reading frame 54 (C1orf54), mGFP tagged 10 ug
$450.00
RC204611L3 Lenti ORF clone of Human chromosome 1 open reading frame 54 (C1orf54), Myc-DDK-tagged 10 ug
$450.00
RC204611L4 Lenti ORF clone of Human chromosome 1 open reading frame 54 (C1orf54), mGFP tagged 10 ug
$450.00
SC122960 C1orf54 (untagged)-Human chromosome 1 open reading frame 54 (C1orf54) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.