THRSP (NM_003251) Human Tagged ORF Clone

SKU
RG204567
THRSP (tGFP-tagged) - Human thyroid hormone responsive (THRSP)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol THRSP
Synonyms Lpgp; LPGP1; S14; SPOT14; THRP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG204567 representing NM_003251
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGTGCTAACCAAGCGTTACCCCAAGAACTGCCTGCTGACCGTCATGGACCGGTATGCAGCCGAGG
TGCACAACATGGAGCAGGTGGTGATGATCCCCAGCCTTCTGCGGGACGTGCAGCTGAGTGGGCCTGGGGG
CCAGGCCCAGGCTGAGGCCCCTGATCTCTACACCTACTTCACCATGCTCAAGGCCATCTGTGTGGATGTG
GACCATGGGCTGCTGCCGCGGGAGGAGTGGCAGGCCAAGGTGGCAGGCAGCGAAGAGAATGGAACCGCAG
AGACAGAGGAAGTCGAGGACGAGAGTGCCTCAGGAGAGCTGGACCTGGAAGCCCAGTTCCACCTGCACTT
CTCCAGCCTCCATCACATCCTCATGCACCTCACCGAGAAAGCCCAGGAGGTGACAAGGAAATACCAGGAA
ATGACGGGACAAGTTTGG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204567 representing NM_003251
Red=Cloning site Green=Tags(s)

MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDV
DHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQE
MTGQVW

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003251
ORF Size 438 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003251.4
RefSeq Size 1207 bp
RefSeq ORF 441 bp
Locus ID 7069
UniProt ID Q92748
Cytogenetics 11q14.1
Protein Families Transcription Factors
Summary The protein encoded by this gene is similar to the gene product of S14, a rat gene whose expression is limited to liver and adipose tissue and is controlled by nutritional and hormonal factors. This gene has been shown to be expressed in liver and adipocytes, particularly in lipomatous modules. It is also found to be expressed in lipogenic breast cancers, which suggests a role in controlling tumor lipid metabolism. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:THRSP (NM_003251) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204567 THRSP (Myc-DDK-tagged)-Human thyroid hormone responsive (THRSP) 10 ug
$150.00
RC204567L1 Lenti ORF clone of Human thyroid hormone responsive (THRSP), Myc-DDK-tagged 10 ug
$450.00
RC204567L2 Lenti ORF clone of Human thyroid hormone responsive (THRSP), mGFP tagged 10 ug
$450.00
RC204567L3 Lenti ORF clone of Human thyroid hormone responsive (THRSP), Myc-DDK-tagged 10 ug
$450.00
RC204567L4 Lenti ORF clone of Human thyroid hormone responsive (THRSP), mGFP tagged 10 ug
$450.00
SC122649 THRSP (untagged)-Human thyroid hormone responsive (THRSP) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.