CMTM5 (NM_138460) Human Tagged ORF Clone

SKU
RG204558
CMTM5 (tGFP-tagged) - Human CKLF-like MARVEL transmembrane domain containing 5 (CMTM5), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CMTM5
Synonyms CKLFSF5
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG204558 representing NM_138460
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTCAGTGCTCGAGATCGCCGGGACCGGCACCCTGAGGAGGGGGTAGTTGCAGAGCTCCAGGGCTTCG
CGGTGGACAAGGCCTTCCTCACCTCCCACAAGGGCATCCTGCTGGAAACCGAGCTGGCCCTGACCCTCAT
CATCTTCATCTGCTTCACGGCCTCCATCTCTGCCTACATGGCCGCGGCGCTACTGGAGTTCTTCATCACA
CTTGCCTTCCTCTTCCTCTATGCCACCCAGTACTACCAGCGCTTCGACCGAATTAACTGGCCCTGTCTGG
ACTTCCTGCGCTGTGTCAGTGCCATCATCATCTTCCTGGTGGTCTCCTTTGCAGCTGTGACCTCCCGGGA
CGGAGCTGCCATTGCTGCTTTTGTTTTTGGCATCATCCTGGTTTCCATCTTTGCCTATGATGCCTTCAAG
ATCTACCGGACTGAGATGGCACCCGGGGCCAGCCAGGGGGACCAGCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204558 representing NM_138460
Red=Cloning site Green=Tags(s)

MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYMAAALLEFFIT
LAFLFLYATQYYQRFDRINWPCLDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFK
IYRTEMAPGASQGDQQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_138460
ORF Size 468 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_138460.3
RefSeq Size 1217 bp
RefSeq ORF 471 bp
Locus ID 116173
UniProt ID Q96DZ9
Cytogenetics 14q11.2
Protein Families Transmembrane
Summary This gene encodes a member of the chemokine-like factor superfamily. This family of genes encodes multi-pass membrane proteins that are similar to both the chemokine and the transmembrane 4 superfamilies of signaling molecules. The encoded protein may exhibit tumor suppressor activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
Write Your Own Review
You're reviewing:CMTM5 (NM_138460) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204558 CMTM5 (Myc-DDK-tagged)-Human CKLF-like MARVEL transmembrane domain containing 5 (CMTM5), transcript variant 1 10 ug
$150.00
RC204558L3 Lenti ORF clone of Human CKLF-like MARVEL transmembrane domain containing 5 (CMTM5), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC204558L4 Lenti ORF clone of Human CKLF-like MARVEL transmembrane domain containing 5 (CMTM5), transcript variant 1, mGFP tagged 10 ug
$450.00
SC322451 CMTM5 (untagged)-Human CKLF-like MARVEL transmembrane domain containing 5 (CMTM5), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.