PFDN2 (NM_012394) Human Tagged ORF Clone

  • TrueORF®
SKU
RG204553
PFDN2 (tGFP-tagged) - Human prefoldin subunit 2 (PFDN2)
  $489.00
In Stock*
Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PFDN2
Synonyms PFD2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG204553 representing NM_012394
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGATAACAGCGGTCGCGCCGGCAAGAGCAGCGGGAGCGGCGCGGGGAAGGGGGCGGTGTCCGCAG
AGCAGGTGATTGCTGGCTTCAACCGCCTTCGGCAGGAACAGCGAGGCCTGGCATCCAAAGCAGCTGAGTT
GGAGATGGAGTTGAATGAGCACAGCCTAGTGATCGATACACTGAAGGAGGTAGATGAAACTCGTAAGTGC
TACCGCATGGTTGGAGGAGTGCTGGTGGAGCGAACTGTCAAAGAGGTGCTGCCCGCTTTGGAGAACAACA
AGGAGCAGATACAGAAGATCATTGAGACACTGACACAGCAGCTTCAGGCAAAGGGAAAAGAACTAAATGA
ATTCCGGGAAAAGCACAACATTCGTCTCATGGGAGAAGATGAGAAGCCAGCAGCCAAGGAAAACTCAGAA
GGGGCTGGGGCTAAGGCCAGCTCAGCTGGAGTGTTGGTCTCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204553 representing NM_012394
Red=Cloning site Green=Tags(s)

MADNSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKC
YRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSE
GAGAKASSAGVLVS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene |
ACCN NM_012394
ORF Size 462 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012394.4
RefSeq Size 668 bp
RefSeq ORF 465 bp
Locus ID 5202
UniProt ID Q9UHV9
Cytogenetics 1q23.3
Domains KE2
Summary This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. provided by RefSeq, Jul 2008
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_012394" in other vectors (6)
SKU Description Size Price
RC204553 PFDN2 (Myc-DDK-tagged)-Human prefoldin subunit 2 (PFDN2) 10 ug
$150.00
RC204553L1 Lenti ORF clone of Human prefoldin subunit 2 (PFDN2), Myc-DDK-tagged 10 ug
$450.00
RC204553L2 Lenti ORF clone of Human prefoldin subunit 2 (PFDN2), mGFP tagged 10 ug
$450.00
RC204553L3 Lenti ORF clone of Human prefoldin subunit 2 (PFDN2), Myc-DDK-tagged 10 ug
$450.00
RC204553L4 Lenti ORF clone of Human prefoldin subunit 2 (PFDN2), mGFP tagged 10 ug
$450.00
SC321686 PFDN2 (untagged)-Human prefoldin subunit 2 (PFDN2) 10 ug
$150.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products