Ubiquitin D (UBD) (NM_006398) Human Tagged ORF Clone

SKU
RG204431
UBD (tGFP-tagged) - Human ubiquitin D (UBD)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$425.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Ubiquitin D
Synonyms FAT10; GABBR1; UBD-3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG204431 representing NM_006398
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCCCAATGCTTCCTGCCTCTGTGTGCATGTCCGTTCCGAGGAATGGGATTTAATGACCTTTGATG
CCAACCCATATGACAGCGTGAAAAAAATCAAAGAACATGTCCGGTCTAAGACCAAGGTTCCTGTGCAGGA
CCAGGTTCTTTTGCTGGGCTCCAAGATCTTAAAGCCACGGAGAAGCCTCTCATCTTATGGCATTGACAAA
GAGAAGACCATCCACCTTACCCTGAAAGTGGTGAAGCCCAGTGATGAGGAGCTGCCCTTGTTTCTTGTGG
AGTCAGGTGATGAGGCAAAGAGGCACCTCCTCCAGGTGCGAAGGTCCAGCTCAGTGGCACAAGTGAAAGC
AATGATCGAGACTAAGACGGGTATAATCCCTGAGACCCAGATTGTGACTTGCAATGGAAAGAGACTGGAA
GATGGGAAGATGATGGCAGATTACGGCATCAGAAAGGGCAACTTACTCTTCCTGGCATGTTATTGCATTG
GAGGG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204431 representing NM_006398
Red=Cloning site Green=Tags(s)

MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDK
EKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLE
DGKMMADYGIRKGNLLFLACYCIGG

TRTRPLE - GFP Tag - V
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006398
ORF Size 495 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006398.2, NP_006389.1
RefSeq Size 971 bp
RefSeq ORF 498 bp
Locus ID 10537
UniProt ID O15205
Cytogenetics 6p22.1
Domains UBQ
Protein Families Druggable Genome
Summary This gene encodes a protein which contains two ubiquitin-like domains and appears to have similar function to ubiquitin. Through covalent attachment, the encoded protein targets other proteins for 26S proteasome degradation. This protein has been implicated to function in many cellular processes, including caspase-dependent apoptosis, formation of aggresomes, mitotic regulation, and dendritic cell maturation. Upregulation of this gene may promote inflammation in chronic kidney disease and has been observed in many cancer types. [provided by RefSeq, Aug 2017]
Write Your Own Review
You're reviewing:Ubiquitin D (UBD) (NM_006398) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204431 UBD (Myc-DDK-tagged)-Human ubiquitin D (UBD) 10 ug
$225.00
RC204431L1 Lenti ORF clone of Human ubiquitin D (UBD), Myc-DDK-tagged 10 ug
$525.00
RC204431L2 Lenti ORF clone of Human ubiquitin D (UBD), mGFP tagged 10 ug
$525.00
RC204431L3 Lenti ORF clone of Human ubiquitin D (UBD), Myc-DDK-tagged 10 ug
$525.00
RC204431L4 Lenti ORF clone of Human ubiquitin D (UBD), mGFP tagged 10 ug
$525.00
SC116089 UBD (untagged)-Human ubiquitin D (UBD) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.