SCAND1 (NM_016558) Human Tagged ORF Clone

SKU
RG204370
SCAND1 (tGFP-tagged) - Human SCAN domain containing 1 (SCAND1), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SCAND1
Synonyms RAZ1; SDP1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG204370 representing NM_016558
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCTACGGAGCCGATCTTGGCGGCCACTGGGAGTCCCGCGGCGGTGCCACCGGAGAAACTGGAAG
GAGCCGGTTCGAGCTCAGCCCCTGAGCGTAACTGTGTGGGCTCCTCGCTGCCAGAGGCCTCACCGCCTGC
CCCTGAGCCTTCCAGTCCCAACGCCGCGGTCCCTGAAGCCATCCCTACGCCCCGAGCTGCGGCCTCCGCG
GCCCTGGAGCTGCCTCTCGGGCCCGCACCCGTGAGCGTAGCGCCTCAGGCCGAAGCTGAAGCGCGCTCCA
CACCAGGCCCCGCCGGCTCTAGACTCGGTCCCGAGACGTTCCGCCAGCGTTTCCGGCAGTTCCGCTACCA
GGATGCGGCGGGTCCCCGGGAGGCTTTCCGGCAGCTGCGGGAGCTGTCCCGCCAGTGGCTGCGGCCTGAC
ATCCGCACCAAGGAGCAGATCGTGGAGATGCTGGTGCAAGAGCAGCTGCTCGCCATCCTGCCCGAGGCGG
CTCGGGCCCGGCGGATCCGCCGCCGCACGGATGTGCGCATCACTGGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204370 representing NM_016558
Red=Cloning site Green=Tags(s)

MAATEPILAATGSPAAVPPEKLEGAGSSSAPERNCVGSSLPEASPPAPEPSSPNAAVPEAIPTPRAAASA
ALELPLGPAPVSVAPQAEAEARSTPGPAGSRLGPETFRQRFRQFRYQDAAGPREAFRQLRELSRQWLRPD
IRTKEQIVEMLVQEQLLAILPEAARARRIRRRTDVRITG

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016558
ORF Size 537 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016558.3
RefSeq Size 916 bp
RefSeq ORF 540 bp
Locus ID 51282
UniProt ID P57086
Cytogenetics 20q11.23
Domains LER
Protein Families Transcription Factors
Summary This gene encodes a SCAN box domain-containing protein. The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. This gene belongs to a family of genes that encode an isolated SCAN domain, but no zinc finger motif. This protein binds to and may regulate the function of the transcription factor myeloid zinc finger 1B. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Jan 2011]
Write Your Own Review
You're reviewing:SCAND1 (NM_016558) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204370 SCAND1 (Myc-DDK-tagged)-Human SCAN domain containing 1 (SCAND1), transcript variant 1 10 ug
$300.00
RC204370L3 Lenti ORF clone of Human SCAN domain containing 1 (SCAND1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC204370L4 Lenti ORF clone of Human SCAN domain containing 1 (SCAND1), transcript variant 1, mGFP tagged 10 ug
$600.00
SC110441 SCAND1 (untagged)-Human SCAN domain containing 1 (SCAND1), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.