gamma Synuclein (SNCG) (NM_003087) Human Tagged ORF Clone

SKU
RG204173
SNCG (tGFP-tagged) - Human synuclein, gamma (breast cancer-specific protein 1) (SNCG)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol gamma Synuclein
Synonyms BCSG1; SR
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG204173 representing NM_003087
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATGTCTTCAAGAAGGGCTTCTCCATCGCCAAGGAGGGCGTGGTGGGTGCGGTGGAAAAGACCAAGC
AGGGGGTGACGGAAGCAGCTGAGAAGACCAAGGAGGGGGTCATGTATGTGGGAGCCAAGACCAAGGAGAA
TGTTGTACAGAGCGTGACCTCAGTGGCCGAGAAGACCAAGGAGCAGGCCAACGCCGTGAGCGAGGCTGTG
GTGAGCAGCGTCAACACTGTGGCCACCAAGACCGTGGAGGAGGCGGAGAACATCGCGGTCACCTCCGGGG
TGGTGCGCAAGGAGGACTTGAGGCCATCTGCCCCCCAACAGGAGGGTGAGGCATCCAAAGAGAAAGAGGA
AGTGGCAGAGGAGGCCCAGAGTGGGGGAGAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204173 representing NM_003087
Red=Cloning site Green=Tags(s)

MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAV
VSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003087
ORF Size 381 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003087.3
RefSeq Size 720 bp
RefSeq ORF 384 bp
Locus ID 6623
UniProt ID O76070
Cytogenetics 10q23.2
Domains Synuclein
Summary This gene encodes a member of the synuclein family of proteins which are believed to be involved in the pathogenesis of neurodegenerative diseases. Mutations in this gene have also been associated with breast tumor development. [provided by RefSeq, Jan 2010]
Write Your Own Review
You're reviewing:gamma Synuclein (SNCG) (NM_003087) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204173 SNCG (Myc-DDK-tagged)-Human synuclein, gamma (breast cancer-specific protein 1) (SNCG) 10 ug
$150.00
RC204173L3 Lenti ORF clone of Human synuclein, gamma (breast cancer-specific protein 1) (SNCG), Myc-DDK-tagged 10 ug
$450.00
RC204173L4 Lenti ORF clone of Human synuclein, gamma (breast cancer-specific protein 1) (SNCG), mGFP tagged 10 ug
$450.00
SC118221 SNCG (untagged)-Human synuclein, gamma (breast cancer-specific protein 1) (SNCG) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.