SF20 (MYDGF) (NM_019107) Human Tagged ORF Clone

SKU
RG204011
C19orf10 (tGFP-tagged) - Human chromosome 19 open reading frame 10 (C19orf10)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SF20
Synonyms C19orf10; EUROIMAGE1875335; IL25; IL27; IL27w; R33729_1; SF20
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG204011 representing NM_019107
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGCCCAGCGGAGGGTGGAACGGCGTCGGCGCGAGCTTGTGGGCCGCGCTGCTCCTAGGGGCCG
TGGCGCTGAGGCCGGCGGAGGCGGTGTCCGAGCCCACGACGGTGGCGTTTGACGTGCGGCCCGGCGGCGT
CGTGCATTCCTTCTCCCATAACGTGGGCCCGGGGGACAAATATACGTGTATGTTCACTTACGCCTCTCAA
GGAGGGACCAATGAGCAATGGCAGATGAGTCTGGGGACCAGCGAAGACCACCAGCACTTCACCTGCACCA
TCTGGAGGCCCCAGGGGAAGTCCTATCTGTACTTCACACAGTTCAAGGCAGAGGTGCGGGGCGCTGAGAT
TGAGTACGCCATGGCCTACTCTAAAGCCGCATTTGAAAGGGAAAGTGATGTCCCTCTGAAAACTGAGGAA
TTTGAAGTGACCAAAACAGCAGTGGCTCACAGGCCCGGGGCATTCAAAGCTGAGCTGTCCAAGCTGGTGA
TTGTGGCCAAGGCATCGCGCACTGAGCTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204011 representing NM_019107
Red=Cloning site Green=Tags(s)

MAAPSGGWNGVGASLWAALLLGAVALRPAEAVSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQ
GGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEE
FEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_019107
ORF Size 519 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_019107.4
RefSeq Size 1067 bp
RefSeq ORF 522 bp
Locus ID 56005
UniProt ID Q969H8
Cytogenetics 19p13.3
Protein Families Secreted Protein
Summary The protein encoded by this gene was previously thought to support proliferation of lymphoid cells and was considered an interleukin. However, this activity has not been reproducible and the function of this protein is currently unknown. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:SF20 (MYDGF) (NM_019107) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204011 C19orf10 (Myc-DDK-tagged)-Human chromosome 19 open reading frame 10 (C19orf10) 10 ug
$300.00
RC204011L1 Lenti ORF clone of Human chromosome 19 open reading frame 10 (C19orf10), Myc-DDK-tagged 10 ug
$600.00
RC204011L2 Lenti ORF clone of Human chromosome 19 open reading frame 10 (C19orf10), mGFP tagged 10 ug
$600.00
RC204011L3 Lenti ORF clone of Human chromosome 19 open reading frame 10 (C19orf10), Myc-DDK-tagged 10 ug
$600.00
RC204011L4 Lenti ORF clone of Human chromosome 19 open reading frame 10 (C19orf10), mGFP tagged 10 ug
$600.00
SC111352 C19orf10 (untagged)-Human chromosome 19 open reading frame 10 (C19orf10) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.