Midkine (MDK) (NM_001012333) Human Tagged ORF Clone

SKU
RG203995
MDK (tGFP-tagged) - Human midkine (neurite growth-promoting factor 2) (MDK), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Midkine
Synonyms ARAP; MK; NEGF2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG203995 representing NM_001012333
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGCACCGAGGCTTCCTCCTCCTCACCCTCCTCGCCCTGCTGGCGCTCACCTCCGCGGTCGCCAAAA
AGAAAGATAAGGTGAAGAAGGGCGGCCCGGGGAGCGAGTGCGCTGAGTGGGCCTGGGGGCCCTGCACCCC
CAGCAGCAAGGATTGCGGCGTGGGTTTCCGCGAGGGCACCTGCGGGGCCCAGACCCAGCGCATCCGGTGC
AGGGTGCCCTGCAACTGGAAGAAGGAGTTTGGAGCCGACTGCAAGTACAAGTTTGAGAACTGGGGTGCGT
GTGATGGGGGCACAGGCACCAAAGTCCGCCAAGGCACCCTGAAGAAGGCGCGCTACAATGCTCAGTGCCA
GGAGACCATCCGCGTCACCAAGCCCTGCACCCCCAAGACCAAAGCAAAGGCCAAAGCCAAGAAAGGGAAG
GGAAAGGAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203995 representing NM_001012333
Red=Cloning site Green=Tags(s)

MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRC
RVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGK
GKD

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001012333
ORF Size 429 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001012333.2
RefSeq Size 909 bp
RefSeq ORF 432 bp
Locus ID 4192
UniProt ID P21741
Cytogenetics 11p11.2
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Summary This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targeted as a therapeutic for a variety of different disorders. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2012]
Write Your Own Review
You're reviewing:Midkine (MDK) (NM_001012333) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203995 MDK (Myc-DDK-tagged)-Human midkine (neurite growth-promoting factor 2) (MDK), transcript variant 2 10 ug
$150.00
RC203995L1 Lenti ORF clone of Human midkine (neurite growth-promoting factor 2) (MDK), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC203995L2 Lenti ORF clone of Human midkine (neurite growth-promoting factor 2) (MDK), transcript variant 2, mGFP tagged 10 ug
$450.00
RC203995L3 Lenti ORF clone of Human midkine (neurite growth-promoting factor 2) (MDK), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC203995L4 Lenti ORF clone of Human midkine (neurite growth-promoting factor 2) (MDK), transcript variant 2, mGFP tagged 10 ug
$450.00
SC319913 MDK (untagged)-Human midkine (neurite growth-promoting factor 2) (MDK), transcript variant 2 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.