S100 alpha 6 (S100A6) (NM_014624) Human Tagged ORF Clone

SKU
RG203951
S100A6 (tGFP-tagged) - Human S100 calcium binding protein A6 (S100A6)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$425.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol S100 alpha 6
Synonyms 2A9; 5B10; CABP; CACY; PRA; S10A6
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG203951 representing NM_014624
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCATGCCCCCTGGATCAGGCCATTGGCCTCCTCGTGGCCATCTTCCACAAGTACTCCGGCAGGGAGG
GTGACAAGCACACCCTGAGCAAGAAGGAGCTGAAGGAGCTGATCCAGAAGGAGCTCACCATTGGCTCGAA
GCTGCAGGATGCTGAAATTGCAAGGCTGATGGAAGACTTGGACCGGAACAAGGACCAGGAGGTGAACTTC
CAGGAGTATGTCACCTTCCTGGGGGCCTTGGCTTTGATCTACAATGAAGCCCTCAAGGGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203951 representing NM_014624
Red=Cloning site Green=Tags(s)

MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNF
QEYVTFLGALALIYNEALKG

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014624
ORF Size 270 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014624.4
RefSeq Size 683 bp
RefSeq ORF 273 bp
Locus ID 6277
UniProt ID P06703
Cytogenetics 1q21.3
Domains EFh, S_100
Summary The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:S100 alpha 6 (S100A6) (NM_014624) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203951 S100A6 (Myc-DDK-tagged)-Human S100 calcium binding protein A6 (S100A6) 10 ug
$225.00
RC203951L1 Lenti ORF clone of Human S100 calcium binding protein A6 (S100A6), Myc-DDK-tagged 10 ug
$525.00
RC203951L2 Lenti ORF clone of Human S100 calcium binding protein A6 (S100A6), mGFP tagged 10 ug
$525.00
RC203951L3 Lenti ORF clone of Human S100 calcium binding protein A6 (S100A6), Myc-DDK-tagged 10 ug
$525.00
RC203951L4 Lenti ORF clone of Human S100 calcium binding protein A6 (S100A6), mGFP tagged 10 ug
$525.00
SC114957 S100A6 (untagged)-Human S100 calcium binding protein A6 (S100A6) 10 ug
$225.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.