CNRIP1 (NM_015463) Human Tagged ORF Clone

SKU
RG203901
CNRIP1 (tGFP-tagged) - Human cannabinoid receptor interacting protein 1 (CNRIP1), transcript variant CRIP1a
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CNRIP1
Synonyms C2orf32; CRIP-1; CRIP1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG203901 representing NM_015463
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGGACCTGCCGGGCCTCGTGCGCCTCTCCATCGCGCTGCGCATCCAGCCTAATGACGGCCCGGTCT
TTTACAAGGTGGACGGGCAGCGCTTCGGCCAGAACCGCACCATCAAGCTGCTCACCGGCTCCTCCTACAA
GGTTGAGGTGAAGATTAAACCCAGCACGCTGCAGGTCGAGAATATTTCCATTGGTGGTGTGCTTGTCCCA
CTGGAACTGAAGTCTAAAGAGCCTGATGGGGACAGAGTTGTTTATACGGGTACATATGACACAGAAGGTG
TGACCCCAACGAAGAGTGGAGAACGGCAACCCATCCAGATCACCATGCCGTTCACAGACATTGGGACCTT
CGAGACAGTGTGGCAAGTCAAGTTCTACAATTACCACAAGCGGGATCACTGCCAGTGGGGAAGCCCCTTC
TCTGTCATTGAGTATGAATGCAAGCCCAACGAGACACGCAGTCTGATGTGGGTGAACAAGGAGTCCTTCC
TC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203901 representing NM_015463
Red=Cloning site Green=Tags(s)

MGDLPGLVRLSIALRIQPNDGPVFYKVDGQRFGQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVP
LELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPF
SVIEYECKPNETRSLMWVNKESFL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_015463
ORF Size 492 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_015463.3
RefSeq Size 1697 bp
RefSeq ORF 495 bp
Locus ID 25927
UniProt ID Q96F85
Cytogenetics 2p14
Summary This gene encodes a protein that interacts with the C-terminal tail of cannabinoid receptor 1. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2013]
Write Your Own Review
You're reviewing:CNRIP1 (NM_015463) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203901 CNRIP1 (Myc-DDK-tagged)-Human cannabinoid receptor interacting protein 1 (CNRIP1), transcript variant CRIP1a 10 ug
$150.00
RC203901L1 Lenti ORF clone of Human cannabinoid receptor interacting protein 1 (CNRIP1), transcript variant CRIP1a, Myc-DDK-tagged 10 ug
$450.00
RC203901L2 Lenti ORF clone of Human cannabinoid receptor interacting protein 1 (CNRIP1), transcript variant CRIP1a, mGFP tagged 10 ug
$450.00
RC203901L3 Lenti ORF clone of Human cannabinoid receptor interacting protein 1 (CNRIP1), transcript variant CRIP1a, Myc-DDK-tagged 10 ug
$450.00
RC203901L4 Lenti ORF clone of Human cannabinoid receptor interacting protein 1 (CNRIP1), transcript variant CRIP1a, mGFP tagged 10 ug
$450.00
SC100919 CNRIP1 (untagged)-Human cannabinoid receptor interacting protein 1 (CNRIP1), transcript variant CRIP1a 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.