RGS13 (NM_144766) Human Tagged ORF Clone

SKU
RG203804
RGS13 (tGFP-tagged) - Human regulator of G-protein signaling 13 (RGS13), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RGS13
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG203804 representing NM_144766
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCAGGCGGAATTGTTGGATTTGTAAGATGTGCAGAGATGAATCTAAGAGGCCCCCTTCAAACCTTA
CTTTGGAGGAAGTATTACAGTGGGCCCAGTCTTTTGAAAATTTAATGGCTACAAAATATGGTCCAGTAGT
CTATGCAGCATATTTAAAAATGGAGCACAGTGACGAGAATATTCAATTCTGGATGGCATGTGAAACCTAT
AAGAAAATTGCCTCACGGTGGAGCAGAATTTCTAGGGCAAAGAAGCTTTATAAGATTTACATCCAGCCAC
AGTCCCCTAGAGAGATTAACATTGACAGTTCGACAAGAGAGACTATCATCAGGAACATTCAGGAACCCAC
TGAAACATGTTTTGAAGAAGCTCAGAAAATAGTCTATATGCATATGGAAAGGGATTCCTACCCCAGATTT
CTAAAGTCAGAAATGTACCAAAAACTTTTGAAAACTATGCAGTCCAACAACAGTTTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203804 representing NM_144766
Red=Cloning site Green=Tags(s)

MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDENIQFWMACETY
KKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRF
LKSEMYQKLLKTMQSNNSF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_144766
ORF Size 477 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_144766.3
RefSeq Size 1458 bp
RefSeq ORF 480 bp
Locus ID 6003
UniProt ID O14921
Cytogenetics 1q31.2
Protein Families Druggable Genome
Summary The protein encoded by this gene is a member of the regulator of G protein signaling (RGS) family. RGS family members share similarity with S. cerevisiae SST2 and C. elegans egl-10 proteins, which contain a characteristic conserved RGS domain. RGS proteins accelerate GTPase activity of G protein alpha-subunits, thereby driving G protein into their inactive GDP-bound form, thus negatively regulating G protein signaling. RGS proteins have been implicated in the fine tuning of a variety of cellular events in response to G protein-coupled receptor activation. The biological function of this gene, however, is unknown. Two transcript variants encoding the same isoform exist. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:RGS13 (NM_144766) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203804 RGS13 (Myc-DDK-tagged)-Human regulator of G-protein signaling 13 (RGS13), transcript variant 2 10 ug
$150.00
RC203804L3 Lenti ORF clone of Human regulator of G-protein signaling 13 (RGS13), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC203804L4 Lenti ORF clone of Human regulator of G-protein signaling 13 (RGS13), transcript variant 2, mGFP tagged 10 ug
$450.00
SC123194 RGS13 (untagged)-Human regulator of G-protein signaling 13 (RGS13), transcript variant 2 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.