PCP4 (NM_006198) Human Tagged ORF Clone

SKU
RG203796
PCP4 (tGFP-tagged) - Human Purkinje cell protein 4 (PCP4)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PCP4
Synonyms PEP-19
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG203796 representing NM_006198
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGAGCGACAAGGTGCTGGGGCAACCAATGGAAAAGACAAGACATCTGGTGAAAATGATGGACAGA
AGAAAGTTCAAGAAGAATTTGACATTGACATGGATGCACCAGAGACAGAACGTGCAGCGGTGGCCATTCA
GTCTCAGTTCAGAAAATTCCAGAAGAAGAAGGCTGGGTCTCAGTCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203796 representing NM_006198
Red=Cloning site Green=Tags(s)

MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006198
ORF Size 186 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006198.3
RefSeq Size 566 bp
RefSeq ORF 189 bp
Locus ID 5121
UniProt ID P48539
Cytogenetics 21q22.2
Summary Functions as a modulator of calcium-binding by calmodulin. Thereby, regulates calmodulin activity and the different processes it controls (PubMed:19106096, PubMed:23204517, PubMed:27876793). For instance, may play a role in neuronal differentiation through activation of calmodulin-dependent kinase signaling pathways (PubMed:21491429).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PCP4 (NM_006198) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203796 PCP4 (Myc-DDK-tagged)-Human Purkinje cell protein 4 (PCP4) 10 ug
$150.00
RC203796L3 Lenti ORF clone of Human Purkinje cell protein 4 (PCP4), Myc-DDK-tagged 10 ug
$450.00
RC203796L4 Lenti ORF clone of Human Purkinje cell protein 4 (PCP4), mGFP tagged 10 ug
$450.00
SC116304 PCP4 (untagged)-Human Purkinje cell protein 4 (PCP4) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.