ATP6V0C (NM_001694) Human Tagged ORF Clone

SKU
RG203652
ATP6V0C (tGFP-tagged) - Human ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c (ATP6V0C), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ATP6V0C
Synonyms ATP6C; ATP6L; ATPL; VATL; Vma3; VPPC
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG203652 representing NM_001694
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCGAGTCCAAGAGCGGCCCCGAGTATGCTTCGTTTTTCGCCGTCATGGGCGCCTCGGCCGCCATGG
TCTTCAGCGCCCTGGGCGCTGCCTATGGCACAGCCAAGAGCGGTACCGGCATTGCGGCCATGTCTGTCAT
GCGGCCGGAGCAGATCATGAAGTCCATCATCCCAGTGGTCATGGCTGGCATCATCGCCATCTACGGCCTG
GTGGTGGCAGTCCTCATCGCCAACTCCCTGAATGACGACATCAGCCTCTACAAGAGCTTCCTCCAGCTGG
GCGCCGGCCTGAGCGTGGGCCTGAGCGGCCTGGCAGCCGGCTTTGCCATCGGCATCGTGGGGGACGCTGG
CGTGCGGGGCACCGCCCAGCAGCCCCGACTATTCGTGGGCATGATCCTGATTCTCATCTTCGCCGAGGTG
CTCGGCCTCTACGGTCTCATCGTCGCCCTCATCCTCTCCACAAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203652 representing NM_001694
Red=Cloning site Green=Tags(s)

MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGL
VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEV
LGLYGLIVALILSTK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001694
ORF Size 465 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001694.4
RefSeq Size 1126 bp
RefSeq ORF 468 bp
Locus ID 527
UniProt ID P27449
Cytogenetics 16p13.3
Domains ATP-synt_C
Protein Families Transmembrane
Protein Pathways Epithelial cell signaling in Helicobacter pylori infection, Lysosome, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection
Summary This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. This gene encodes the V0 subunit c. Alternative splicing results in transcript variants. Pseudogenes have been identified on chromosomes 6 and 17. [provided by RefSeq, Nov 2010]
Write Your Own Review
You're reviewing:ATP6V0C (NM_001694) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203652 ATP6V0C (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c (ATP6V0C), transcript variant 1 10 ug
$150.00
RC203652L1 Lenti ORF clone of Human ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c (ATP6V0C), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC203652L2 Lenti ORF clone of Human ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c (ATP6V0C), transcript variant 1, mGFP tagged 10 ug
$450.00
RC203652L3 Lenti ORF clone of Human ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c (ATP6V0C), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC203652L4 Lenti ORF clone of Human ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c (ATP6V0C), transcript variant 1, mGFP tagged 10 ug
$450.00
SC119084 ATP6V0C (untagged)-Human ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c (ATP6V0C), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.