Cofilin 1 (CFL1) (NM_005507) Human Tagged ORF Clone

SKU
RG203585
CFL1 (tGFP-tagged) - Human cofilin 1 (non-muscle) (CFL1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Cofilin 1
Synonyms CFL; cofilin; HEL-S-15
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG203585 representing NM_005507
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTCCGGTGTGGCTGTCTCTGATGGTGTCATCAAGGTGTTCAACGACATGAAGGTGCGTAAGTCTT
CAACGCCAGAGGAGGTGAAGAAGCGCAAGAAGGCGGTGCTCTTCTGCCTGAGTGAGGACAAGAAGAACAT
CATCCTGGAGGAGGGCAAGGAGATCCTGGTGGGCGATGTGGGCCAGACTGTCGACGATCCCTACGCCACC
TTTGTCAAGATGCTGCCAGATAAGGACTGCCGCTATGCCCTCTATGATGCAACCTATGAGACCAAGGAGA
GCAAGAAGGAGGATCTGGTGTTTATCTTCTGGGCCCCCGAGTCTGCGCCCCTTAAGAGCAAAATGATTTA
TGCCAGCTCCAAGGACGCCATCAAGAAGAAGCTGACAGGGATCAAGCATGAATTGCAAGCAAACTGCTAC
GAGGAGGTCAAGGACCGCTGCACCCTGGCAGAGAAGCTGGGGGGCAGTGCCGTCATCTCCCTGGAGGGCA
AGCCTTTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203585 representing NM_005507
Red=Cloning site Green=Tags(s)

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYAT
FVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCY
EEVKDRCTLAEKLGGSAVISLEGKPL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005507
ORF Size 498 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005507.2, NP_005498.1
RefSeq Size 1260 bp
RefSeq ORF 501 bp
Locus ID 1072
UniProt ID P23528
Cytogenetics 11q13.1
Domains ADF
Protein Families Druggable Genome
Protein Pathways Axon guidance, Fc gamma R-mediated phagocytosis, Regulation of actin cytoskeleton
Summary The protein encoded by this gene can polymerize and depolymerize F-actin and G-actin in a pH-dependent manner. Increased phosphorylation of this protein by LIM kinase aids in Rho-induced reorganization of the actin cytoskeleton. Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.[supplied by OMIM, Apr 2004]
Write Your Own Review
You're reviewing:Cofilin 1 (CFL1) (NM_005507) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203585 CFL1 (Myc-DDK-tagged)-Human cofilin 1 (non-muscle) (CFL1) 10 ug
$150.00
RC203585L1 Lenti ORF clone of Human cofilin 1 (non-muscle) (CFL1), Myc-DDK-tagged 10 ug
$450.00
RC203585L2 Lenti ORF clone of Human cofilin 1 (non-muscle) (CFL1), mGFP tagged 10 ug
$450.00
RC203585L3 Lenti ORF clone of Human cofilin 1 (non-muscle) (CFL1), Myc-DDK-tagged 10 ug
$450.00
RC203585L4 Lenti ORF clone of Human cofilin 1 (non-muscle) (CFL1), mGFP tagged 10 ug
$450.00
SC116694 CFL1 (untagged)-Human cofilin 1 (non-muscle) (CFL1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.