ERp19 (TXNDC12) (NM_015913) Human Tagged ORF Clone

SKU
RG203511
TXNDC12 (tGFP-tagged) - Human thioredoxin domain containing 12 (endoplasmic reticulum) (TXNDC12)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ERp19
Synonyms AG1; AGR1; ERP16; ERP18; ERP19; hAG-1; hTLP19; PDIA16; TLP19
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG203511 representing NM_015913
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGACGCGGCCTCGTCTCGGGGCCACCTGTTTGCTGGGCTTCAGTTTCCTGCTCCTCGTCATCTCTT
CTGATGGACATAATGGGCTTGGAAAGGGTTTTGGAGATCATATTCATTGGAGGACACTGGAAGATGGGAA
GAAAGAAGCAGCTGCCAGTGGACTGCCCCTGATGGTGATTATTCATAAATCCTGGTGTGGAGCTTGCAAA
GCTCTAAAGCCCAAATTTGCAGAATCTACGGAAATTTCAGAACTCTCCCATAATTTTGTTATGGTAAATC
TTGAGGATGAAGAGGAACCCAAACATGAAGATTTCAGCCCTGACGGGGGTTATATTCCACGAATCCTTTT
TCTGGATCCCAGTGGCAAGGTGCATCCTGAAATCATCAATGAGAATGGAAACCCCAGCTACAAGTATTTT
TATGTCAGTGCCGAGCAAGTTGTTCAGGGGATGAAGGAAGCTCAGGAAAGGCTGACGGGTGATGCCTTCA
GAAAGAAACATCTTGAAGATGAATTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203511 representing NM_015913
Red=Cloning site Green=Tags(s)

METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACK
ALKPKFAESTEISELSHNFVMVNLEDEEEPKHEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYF
YVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_015913
ORF Size 516 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_015913.2, NP_056997.1
RefSeq Size 1616 bp
RefSeq ORF 519 bp
Locus ID 51060
UniProt ID O95881
Cytogenetics 1p32.3
Protein Families Druggable Genome, Transmembrane
Protein Pathways Glutathione metabolism
Summary This gene encodes a member of the thioredoxin superfamily. Members of this family are characterized by a conserved active motif called the thioredoxin fold that catalyzes disulfide bond formation and isomerization. This protein localizes to the endoplasmic reticulum and has a single atypical active motif. The encoded protein is mainly involved in catalyzing native disulfide bond formation and displays activity similar to protein-disulfide isomerases. This protein may play a role in defense against endoplasmic reticulum stress. Alternate splicing results in both coding and non-coding variants. [provided by RefSeq, Mar 2012]
Write Your Own Review
You're reviewing:ERp19 (TXNDC12) (NM_015913) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203511 TXNDC12 (Myc-DDK-tagged)-Human thioredoxin domain containing 12 (endoplasmic reticulum) (TXNDC12) 10 ug
$300.00
RC203511L3 Lenti ORF clone of Human thioredoxin domain containing 12 (endoplasmic reticulum) (TXNDC12), Myc-DDK-tagged 10 ug
$600.00
RC203511L4 Lenti ORF clone of Human thioredoxin domain containing 12 (endoplasmic reticulum) (TXNDC12), mGFP tagged 10 ug
$600.00
SC114591 TXNDC12 (untagged)-Human thioredoxin domain containing 12 (endoplasmic reticulum) (TXNDC12) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.