RAB25 (NM_020387) Human Tagged ORF Clone

SKU
RG203413
RAB25 (tGFP-tagged) - Human RAB25, member RAS oncogene family (RAB25)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$650.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RAB25
Synonyms CATX-8; RAB11C
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG203413 representing NM_020387
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGAATGGAACTGAGGAAGATTATAACTTTGTCTTCAAGGTGGTGCTGATCGGCGAATCAGGTGTGG
GGAAGACCAATCTACTCTCCCGATTCACGCGCAATGAGTTCAGCCACGACAGCCGCACCACCATCGGGGT
TGAGTTCTCCACCCGCACTGTGATGTTGGGCACCGCTGCTGTCAAGGCTCAGATCTGGGACACAGCTGGC
CTGGAGCGGTACCGAGCCATCACCTCGGCGTACTATCGTGGTGCAGTGGGGGCCCTCCTGGTGTTTGACC
TAACCAAGCACCAGACCTATGCTGTGGTGGAGCGATGGCTGAAGGAGCTCTATGACCATGCTGAAGCCAC
GATCGTCGTCATGCTCGTGGGTAACAAAAGTGACCTCAGCCAGGCCCGGGAAGTGCCCACTGAGGAGGCC
CGAATGTTCGCTGAAAACAATGGACTGCTCTTCCTGGAGACCTCAGCCCTGGACTCTACCAATGTTGAGC
TAGCCTTTGAGACTGTCCTGAAAGAAATCTTTGCGAAGGTGTCCAAGCAGAGACAGAACAGCATCCGGAC
CAATGCCATCACTCTGGGCAGTGCCCAGGCTGGACAGGAGCCTGGCCCTGGGGAGAAGAGGGCCTGTTGC
ATCAGCCTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203413 representing NM_020387
Red=Cloning site Green=Tags(s)

MGNGTEEDYNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDTAG
LERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLSQAREVPTEEA
RMFAENNGLLFLETSALDSTNVELAFETVLKEIFAKVSKQRQNSIRTNAITLGSAQAGQEPGPGEKRACC
ISL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_020387
ORF Size 639 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020387.4
RefSeq Size 1022 bp
RefSeq ORF 642 bp
Locus ID 57111
UniProt ID P57735
Cytogenetics 1q22
Domains RAB, RAN, RAS, ras, RHO
Protein Families Druggable Genome, Transcription Factors
Summary The protein encoded by this gene is a member of the RAS superfamily of small GTPases. The encoded protein is involved in membrane trafficking and cell survival. This gene has been found to be a tumor suppressor and an oncogene, depending on the context. Two variants, one protein-coding and the other not, have been found for this gene. [provided by RefSeq, Nov 2015]
Write Your Own Review
You're reviewing:RAB25 (NM_020387) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203413 RAB25 (Myc-DDK-tagged)-Human RAB25, member RAS oncogene family (RAB25) 10 ug
$450.00
RC203413L1 Lenti ORF clone of Human RAB25, member RAS oncogene family (RAB25), Myc-DDK-tagged 10 ug
$750.00
RC203413L2 Lenti ORF clone of Human RAB25, member RAS oncogene family (RAB25), mGFP tagged 10 ug
$750.00
RC203413L3 Lenti ORF clone of Human RAB25, member RAS oncogene family (RAB25), Myc-DDK-tagged 10 ug
$750.00
RC203413L4 Lenti ORF clone of Human RAB25, member RAS oncogene family (RAB25), mGFP tagged 10 ug
$750.00
SC113117 RAB25 (untagged)-Human RAB25, member RAS oncogene family (RAB25) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.