BANF1 (NM_003860) Human Tagged ORF Clone

SKU
RG203270
BANF1 (tGFP-tagged) - Human barrier to autointegration factor 1 (BANF1), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BANF1
Synonyms BAF; BCRP1; D14S1460; NGPS
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG203270 representing NM_003860
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACAACCTCCCAAAAGCACCGAGACTTCGTGGCAGAGCCCATGGGGGAGAAGCCAGTGGGGAGCCTGG
CTGGGATTGGTGAAGTCCTGGGCAAGAAGCTGGAGGAAAGGGGTTTTGACAAGGCCTATGTTGTCCTTGG
CCAGTTTCTGGTGCTAAAGAAAGATGAAGACCTCTTCCGGGAATGGCTGAAAGACACTTGTGGCGCCAAC
GCCAAGCAGTCCCGGGACTGCTTCGGATGCCTTCGAGAGTGGTGCGACGCCTTCTTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203270 representing NM_003860
Red=Cloning site Green=Tags(s)

MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGAN
AKQSRDCFGCLREWCDAFL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003860
ORF Size 267 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003860.4
RefSeq Size 1192 bp
RefSeq ORF 270 bp
Locus ID 8815
UniProt ID O75531
Cytogenetics 11q13.1
Summary The protein encoded by this gene was first identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The protein forms a homodimer which localizes to both the nucleus and cytoplasm and is specifically associated with chromosomes during mitosis. This protein binds to double stranded DNA in a non-specific manner and also binds to LEM-domain containing proteins of the nuclear envelope. This protein is thought to facilitate nuclear reassembly by binding with both DNA and inner nuclear membrane proteins and thereby recruit chromatin to the nuclear periphery. Alternative splicing results in multiple transcript variants encoding the same protein.[provided by RefSeq, Jan 2009]
Write Your Own Review
You're reviewing:BANF1 (NM_003860) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203270 BANF1 (Myc-DDK-tagged)-Human barrier to autointegration factor 1 (BANF1), transcript variant 1 10 ug
$150.00
RC203270L1 Lenti ORF clone of Human barrier to autointegration factor 1 (BANF1), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC203270L2 Lenti ORF clone of Human barrier to autointegration factor 1 (BANF1), transcript variant 1, mGFP tagged 10 ug
$450.00
RC203270L3 Lenti ORF clone of Human barrier to autointegration factor 1 (BANF1), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC203270L4 Lenti ORF clone of Human barrier to autointegration factor 1 (BANF1), transcript variant 1, mGFP tagged 10 ug
$450.00
SC117722 BANF1 (untagged)-Human barrier to autointegration factor 1 (BANF1), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.