HES6 (NM_018645) Human Tagged ORF Clone

SKU
RG203205
HES6 (tGFP-tagged) - Human hairy and enhancer of split 6 (Drosophila) (HES6), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HES6
Synonyms bHLHb41; bHLHc23; C-HAIRY1; HES-6
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG203205 representing NM_018645
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCCACCCGCGGCGCCTGGCCGGGACCGTGTGGGCCGTGAGGATGAGGACGGCTGGGAGACGCGAG
GGGACCGCAAGGCCCGGAAGCCCCTGGTGGAGAAGAAGCGGCGCGCGCGGATCAACGAGAGCCTGCAGGA
GCTGCGGCTGCTGCTGGCGGGCGCCGAGGTGCAGGCCAAGCTGGAGAACGCCGAAGTGCTGGAGCTGACG
GTGCGGCGGGTCCAGGGTGTGCTGCGGGGCCGGGCGCGCGAGCGCGAGCAGCTGCAGGCGGAAGCGAGCG
AGCGCTTCGCTGCCGGCTACATCCAGTGCATGCACGAGGTGCACACGTTCGTGTCCACGTGCCAGGCCAT
CGACGCTACCGTCGCTGCCGAGCTCCTGAACCATCTGCTCGAGTCCATGCCGCTGCGTGAGGGCAGCAGC
TTCCAGGATCTGCTGGGGGACGCCCTGGCGGGGCCACCTAGAGCCCCTGGACGGAGTGGCTGGCCTGCGG
GGGGCGCTCCGGGATCCCCAATACCCAGCCCCCCGGGTCCTGGGGACGACCTGTGCTCCGACCTGGAGGA
GGCCCCTGAGGCTGAACTGAGTCAGGCTCCTGCTGAGGGGCCCGACTTGGTGCCCGCAGCCCTGGGCAGC
CTGACCACAGCCCAAATTGCCCGGAGTGTCTGGAGGCCTTGG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203205 representing NM_018645
Red=Cloning site Green=Tags(s)

MAPPAAPGRDRVGREDEDGWETRGDRKARKPLVEKKRRARINESLQELRLLLAGAEVQAKLENAEVLELT
VRRVQGVLRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDATVAAELLNHLLESMPLREGSS
FQDLLGDALAGPPRAPGRSGWPAGGAPGSPIPSPPGPGDDLCSDLEEAPEAELSQAPAEGPDLVPAALGS
LTTAQIARSVWRPW

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018645
ORF Size 672 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018645.6
RefSeq Size 1375 bp
RefSeq ORF 675 bp
Locus ID 55502
UniProt ID Q96HZ4
Cytogenetics 2q37.3
Domains HLH
Protein Families Druggable Genome, Transcription Factors
Summary This gene encodes a member of a subfamily of basic helix-loop-helix transcription repressors that have homology to the Drosophila enhancer of split genes. Members of this gene family regulate cell differentiation in numerous cell types. The protein encoded by this gene functions as a cofactor, interacting with other transcription factors through a tetrapeptide domain in its C-terminus. Alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Dec 2008]
Write Your Own Review
You're reviewing:HES6 (NM_018645) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203205 HES6 (Myc-DDK-tagged)-Human hairy and enhancer of split 6 (Drosophila) (HES6), transcript variant 1 10 ug
$300.00
RC203205L1 Lenti ORF clone of Human hairy and enhancer of split 6 (Drosophila) (HES6), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC203205L2 Lenti ORF clone of Human hairy and enhancer of split 6 (Drosophila) (HES6), transcript variant 1, mGFP tagged 10 ug
$600.00
RC203205L3 Lenti ORF clone of Human hairy and enhancer of split 6 (Drosophila) (HES6), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC203205L4 Lenti ORF clone of Human hairy and enhancer of split 6 (Drosophila) (HES6), transcript variant 1, mGFP tagged 10 ug
$600.00
SC320145 HES6 (untagged)-Human hairy and enhancer of split 6 (Drosophila) (HES6), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.