ISG20 (NM_002201) Human Tagged ORF Clone

SKU
RG203178
ISG20 (tGFP-tagged) - Human interferon stimulated exonuclease gene 20kDa (ISG20)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ISG20
Synonyms CD25; HEM45
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG203178 representing NM_002201
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGGGAGCCGTGAGGTGGTGGCCATGGACTGCGAGATGGTGGGGCTGGGGCCCCACCGGGAGAGTG
GCCTGGCTCGTTGCAGCCTCGTGAACGTCCACGGTGCTGTGCTGTACGACAAGTTCATCCGGCCTGAGGG
AGAGATCACCGATTACAGAACCCGGGTCAGCGGGGTCACCCCTCAGCACATGGTGGGGGCCACACCATTT
GCCGTGGCCAGGCTAGAGATCCTGCAGCTCCTGAAAGGCAAGCTGGTGGTGGGTCATGACCTGAAGCACG
ACTTCCAGGCACTGAAAGAGGACATGAGCGGCTACACAATCTACGACACGTCCACTGACAGGCTGTTGTG
GCGTGAGGCCAAGCTGGACCACTGCAGGCGTGTCTCCCTGCGGGTGCTGAGTGAGCGCCTCCTGCACAAG
AGCATCCAGAACAGCCTGCTTGGACACAGCTCGGTGGAAGATGCGAGGGCAACGATGGAGCTCTATCAAA
TCTCCCAGAGAATCCGAGCCCGCCGAGGGCTGCCCCGCCTGGCTGTGTCAGAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203178 representing NM_002201
Red=Cloning site Green=Tags(s)

MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPF
AVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHK
SIQNSLLGHSSVEDARATMELYQISQRIRARRGLPRLAVSD

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002201
ORF Size 543 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002201.4, NP_002192.2
RefSeq Size 974 bp
RefSeq ORF 546 bp
Locus ID 3669
UniProt ID Q96AZ6
Cytogenetics 15q26.1
Domains EXOIII
Summary Interferon-induced antiviral exoribonuclease that acts on single-stranded RNA and also has minor activity towards single-stranded DNA. Exhibits antiviral activity against RNA viruses including hepatitis C virus (HCV), hepatitis A virus (HAV) and yellow fever virus (YFV) in an exonuclease-dependent manner. May also play additional roles in the maturation of snRNAs and rRNAs, and in ribosome biogenesis.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ISG20 (NM_002201) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203178 ISG20 (Myc-DDK-tagged)-Human interferon stimulated exonuclease gene 20kDa (ISG20) 10 ug
$300.00
RC203178L1 Lenti ORF clone of Human interferon stimulated exonuclease gene 20kDa (ISG20), Myc-DDK-tagged 10 ug
$600.00
RC203178L2 Lenti ORF clone of Human interferon stimulated exonuclease gene 20kDa (ISG20), mGFP tagged 10 ug
$600.00
RC203178L3 Lenti ORF clone of Human interferon stimulated exonuclease gene 20kDa (ISG20), Myc-DDK-tagged 10 ug
$600.00
RC203178L4 Lenti ORF clone of Human interferon stimulated exonuclease gene 20kDa (ISG20), mGFP tagged 10 ug
$600.00
SC319212 ISG20 (untagged)-Human interferon stimulated exonuclease gene 20kDa (ISG20) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.