HRSP12 (RIDA) (NM_005836) Human Tagged ORF Clone

SKU
RG203107
HRSP12 (tGFP-tagged) - Human heat-responsive protein 12 (HRSP12)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HRSP12
Synonyms hp14.5; HRSP12; P14.5; PSP; UK114
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG203107 representing NM_005836
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGTCCTTGATCAGAAGGGTGATCAGCACCGCGAAAGCCCCAGGGGCCATTGGACCCTACAGTCAAG
CTGTATTAGTCGACAGGACCATTTACATTTCAGGACAGATAGGCATGGACCCTTCAAGTGGACAGCTTGT
GTCAGGAGGGGTAGCAGAAGAAGCTAAACAAGCTCTTAAAAACATGGGTGAAATTCTGAAAGCTGCAGGC
TGTGACTTCACTAACGTGGTGAAAACAACTGTTCTTCTGGCTGACATAAATGACTTCAATACTGTCAATG
AAATCTACAAACAGTATTTCAAGAGTAATTTTCCTGCTAGAGCTGCTTACCAAGTTGCTGCTTTACCCAA
AGGCAGCCGAATTGAAATTGAAGCAGTAGCTATCCAAGGACCACTGACAACGGCATCACTA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203107 representing NM_005836
Red=Cloning site Green=Tags(s)

MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAAG
CDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQGPLTTASL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005836
ORF Size 411 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005836.3
RefSeq Size 1011 bp
RefSeq ORF 414 bp
Locus ID 10247
UniProt ID P52758
Cytogenetics 8q22.2
Domains ribonuc_L-PSP
Summary Catalyzes the hydrolytic deamination of enamine/imine intermediates that form during the course of normal metabolism. May facilitate the release of ammonia from these potentially toxic reactive metabolites, reducing their impact on cellular components. It may act on enamine/imine intermediates formed by several types of pyridoxal-5'-phosphate-dependent dehydratases including L-threonine dehydratase.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:HRSP12 (RIDA) (NM_005836) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203107 HRSP12 (Myc-DDK-tagged)-Human heat-responsive protein 12 (HRSP12) 10 ug
$150.00
RC203107L3 Lenti ORF clone of Human heat-responsive protein 12 (HRSP12), Myc-DDK-tagged 10 ug
$450.00
RC203107L4 Lenti ORF clone of Human heat-responsive protein 12 (HRSP12), mGFP tagged 10 ug
$450.00
SC111142 HRSP12 (untagged)-Human heat-responsive protein 12 (HRSP12) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.