LYRM2 (NM_020466) Human Tagged ORF Clone

SKU
RG203091
LYRM2 (tGFP-tagged) - Human LYR motif containing 2 (LYRM2), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LYRM2
Synonyms DJ122O8.2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG203091 representing NM_020466
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCTTCCCGCTTACCCCCAGCGACGCTAACGTTAAAGCAGTTCGTAAGAAGGCAACAAGTTCTTC
TCCTCTACAGAAGGATTTTGCAAACAATTCGGCAAGTTCCAAATGATTCTGATCGCAAATACCTGAAAGA
TTGGGCAAGAGAAGAATTCAGAAGAAACAAAAGTGCCACCGAAGAGGATACAATCCGGATGATGATTACT
CAAGGCAATATGCAGCTCAAGGAGTTAGAAAAAACACTTGCTTTAGCAAAATCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203091 representing NM_020466
Red=Cloning site Green=Tags(s)

MAASRLPPATLTLKQFVRRQQVLLLYRRILQTIRQVPNDSDRKYLKDWAREEFRRNKSATEEDTIRMMIT
QGNMQLKELEKTLALAKS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_020466
ORF Size 264 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020466.5
RefSeq Size 5371 bp
RefSeq ORF 267 bp
Locus ID 57226
UniProt ID Q9NU23
Cytogenetics 6q15
Domains Complex1_LYR
Write Your Own Review
You're reviewing:LYRM2 (NM_020466) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203091 LYRM2 (Myc-DDK-tagged)-Human LYR motif containing 2 (LYRM2), transcript variant 1 10 ug
$150.00
RC203091L3 Lenti ORF clone of Human LYR motif containing 2 (LYRM2), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC203091L4 Lenti ORF clone of Human LYR motif containing 2 (LYRM2), transcript variant 1, mGFP tagged 10 ug
$450.00
SC113085 LYRM2 (untagged)-Human LYR motif containing 2 (LYRM2), transcript variant 1 10 ug
$150.00
SC321070 LYRM2 (untagged)-Human LYR motif containing 2 (LYRM2), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.