GST3 (GSTP1) (NM_000852) Human Tagged ORF Clone

SKU
RG203086
GSTP1 (tGFP-tagged) - Human glutathione S-transferase pi 1 (GSTP1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$650.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GST3
Synonyms DFN7; FAEES3; GST3; GSTP; HEL-S-22; PI
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG203086 representing NM_000852
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGCCCTACACCGTGGTCTATTTCCCAGTTCGAGGCCGCTGCGCGGCCCTGCGCATGCTGCTGGCAG
ATCAGGGCCAGAGCTGGAAGGAGGAGGTGGTGACCGTGGAGACGTGGCAGGAGGGCTCACTCAAAGCCTC
CTGCCTATACGGGCAGCTCCCCAAGTTCCAGGACGGAGACCTCACCCTGTACCAGTCCAATACCATCCTG
CGTCACCTGGGCCGCACCCTTGGGCTCTATGGGAAGGACCAGCAGGAGGCAGCCCTGGTGGACATGGTGA
ATGACGGCGTGGAGGACCTCCGCTGCAAATACGTCTCCCTCATCTACACCAACTATGAGGCGGGCAAGGA
TGACTATGTGAAGGCACTGCCCGGGCAACTGAAGCCTTTTGAGACCCTGCTGTCCCAGAACCAGGGAGGC
AAGACCTTCATTGTGGGAGACCAGATCTCCTTCGCTGACTACAACCTGCTGGACTTGCTGCTGATCCATG
AGGTCCTAGCCCCTGGCTGCCTGGATGCGTTCCCCCTGCTCTCAGCATATGTGGGGCGCCTCAGCGCCCG
GCCCAAGCTCAAGGCCTTCCTGGCCTCCCCTGAGTACGTGAACCTCCCCATCAATGGCAACGGGAAACAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203086 representing NM_000852
Red=Cloning site Green=Tags(s)

MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTIL
RHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGG
KTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000852
ORF Size 630 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000852.2, NP_000843.1
RefSeq Size 737 bp
RefSeq ORF 633 bp
Locus ID 2950
UniProt ID P09211
Cytogenetics 11q13.2
Domains GST_C, GST_N
Protein Families Druggable Genome
Protein Pathways Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450, Pathways in cancer, Prostate cancer
Summary Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:GST3 (GSTP1) (NM_000852) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203086 GSTP1 (Myc-DDK-tagged)-Human glutathione S-transferase pi 1 (GSTP1) 10 ug
$450.00
RC203086L1 Lenti ORF clone of Human glutathione S-transferase pi 1 (GSTP1), Myc-DDK-tagged 10 ug
$750.00
RC203086L2 Lenti ORF clone of Human glutathione S-transferase pi 1 (GSTP1), mGFP tagged 10 ug
$750.00
RC203086L3 Lenti ORF clone of Human glutathione S-transferase pi 1 (GSTP1), Myc-DDK-tagged 10 ug
$750.00
RC203086L4 Lenti ORF clone of Human glutathione S-transferase pi 1 (GSTP1), mGFP tagged 10 ug
$750.00
SC119655 GSTP1 (untagged)-Human glutathione S-transferase pi 1 (GSTP1) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.