FXC1 (TIMM10B) (NM_012192) Human Tagged ORF Clone

SKU
RG203083
TIMM10B (tGFP-tagged) - Human fracture callus 1 homolog (rat) (FXC1), nuclear gene encoding mitochondrial protein
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FXC1
Synonyms FXC1; Tim9b; TIM10B
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG203083 representing NM_012192
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCGGCAGCAGCAGCAGCAACAGCAACTGCGAAACCTGCGTGACTTCCTGTTGGTCTACAATCGGA
TGACAGAACTCTGCTTCCAGCGCTGTGTGCCCAGCTTGCACCACCGAGCTCTGGACGCTGAGGAGGAGGC
CTGTCTGCACAGCTGTGCTGGGAAGCTGATCCATTCCAACCACCGCCTCATGGCCGCTTACGTGCAGCTC
ATGCCTGCCCTGGTACAGCGCCGCATCGCAGACTACGAGGCTGCCTCGGCTGTGCCAAGCGTTGCTGCTG
AACAGCCTGGGGTCTCTCCATCAGGCAGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203083 representing NM_012192
Red=Cloning site Green=Tags(s)

MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQL
MPALVQRRIADYEAASAVPSVAAEQPGVSPSGS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_012192
ORF Size 309 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012192.2, NP_036324.1
RefSeq Size 1470 bp
RefSeq ORF 312 bp
Locus ID 26515
UniProt ID Q9Y5J6
Cytogenetics 11p15.4
Domains zf-Tim10_DDP
Summary FXC1, or TIMM10B, belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIM, Apr 2004]
Write Your Own Review
You're reviewing:FXC1 (TIMM10B) (NM_012192) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203083 TIMM10B (Myc-DDK-tagged)-Human fracture callus 1 homolog (rat) (FXC1), nuclear gene encoding mitochondrial protein 10 ug
$150.00
RC203083L3 Lenti ORF clone of Human fracture callus 1 homolog (rat) (FXC1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$450.00
RC203083L4 Lenti ORF clone of Human fracture callus 1 homolog (rat) (FXC1), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$450.00
SC127258 TIMM10B (untagged)-Human fracture callus 1 homolog (rat) (FXC1), nuclear gene encoding mitochondrial protein 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.