NENF (NM_013349) Human Tagged ORF Clone

SKU
RG202850
NENF (tGFP-tagged) - Human neuron derived neurotrophic factor (NENF), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NENF
Synonyms CIR2; SCIRP10; SPUF
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG202850 representing NM_013349
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGGGCCCCGCGCCGCGGCGGCGGCTGCGGCCGCTGGCAGCGCTGGCCCTGGTCCTGGCGCTGGCCC
CGGGGCTGCCCACAGCCCGGGCCGGGCAGACACCGCGCCCTGCCGAGCGGGGGCCCCCAGTGCGGCTTTT
CACCGAGGAGGAGCTGGCCCGCTATGGCGGGGAGGAGGAAGATCAGCCCATCTACTTGGCAGTGAAGGGA
GTGGTGTTTGATGTCACCTCCGGAAAGGAGTTTTATGGACGAGGAGCCCCCTACAATGCCTTGACGGGGA
AGGACTCCACTAGAGGGGTAGCCAAGATGTCCTTGGATCCTGCAGACCTCACCCATGACACTACGGGTCT
CACGGCCAAGGAACTGGAGGCCCTGGATGAGGTCTTCACCAAAGTGTACAAAGCCAAATACCCCATCGTC
GGCTACACTGCCCGGAGAATTCTCAATGAGGATGGCAGCCCTAACCTGGACTTCAAGCCTGAAGACCAGC
CCCATTTTGACATCAAGGATGAGTTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG202850 representing NM_013349
Red=Cloning site Green=Tags(s)

MVGPAPRRRLRPLAALALVLALAPGLPTARAGQTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKG
VVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIV
GYTARRILNEDGSPNLDFKPEDQPHFDIKDEF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_013349
ORF Size 516 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_013349.5
RefSeq Size 944 bp
RefSeq ORF 519 bp
Locus ID 29937
UniProt ID Q9UMX5
Cytogenetics 1q32.3
Domains heme_1
Protein Families Druggable Genome, Secreted Protein
Summary This gene encodes a neurotrophic factor that may play a role in neuron differentiation and development. A pseudogene of this gene is found on chromosome 12. Alternate splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2009]
Write Your Own Review
You're reviewing:NENF (NM_013349) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202850 NENF (Myc-DDK-tagged)-Human neuron derived neurotrophic factor (NENF), transcript variant 1 10 ug
$300.00
RC202850L1 Lenti ORF clone of Human neuron derived neurotrophic factor (NENF), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC202850L2 Lenti ORF clone of Human neuron derived neurotrophic factor (NENF), transcript variant 1, mGFP tagged 10 ug
$600.00
RC202850L3 Lenti ORF clone of Human neuron derived neurotrophic factor (NENF), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC202850L4 Lenti ORF clone of Human neuron derived neurotrophic factor (NENF), transcript variant 1, mGFP tagged 10 ug
$600.00
SC115296 NENF (untagged)-Human neuron derived neurotrophic factor (NENF), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.