TNFAIP8 (NM_014350) Human Tagged ORF Clone

SKU
RG202729
TNFAIP8 (tGFP-tagged) - Human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TNFAIP8
Synonyms GG2-1; MDC-3.13; NDED; SCC-S2; SCCS2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG202729 representing NM_014350
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCACTCCGAAGCAGAAGAATCCAAGGAAGTGGCCACAGATGTCTTTAATTCCAAAAACCTGGCCGTTC
AGGCACAAAAGAAGATCTTGGGTAAAATGGTGTCCAAATCCATCGCCACCACCTTAATAGACGACACAAG
TAGTGAGGTGCTGGATGAGCTCTACAGAGTGACCAGGGAGTACACCCAAAACAAGAAGGAGGCAGAGAAG
ATCATCAAGAACCTCATCAAGACAGTCATCAAGCTGGCCATTCTTTATAGGAATAATCAGTTTAATCAAG
ATGAGCTAGCATTGATGGAGAAATTTAAGAAGAAAGTTCATCAGCTTGCTATGACCGTGGTCAGTTTCCA
TCAGGTGGATTATACCTTTGACCGGAATGTGTTATCCAGGCTGTTAAATGAATGCAGAGAGATGCTGCAC
CAAATCATTCAGCGCCACCTCACTGCCAAGTCACATGGACGGGTTAATAATGTGTTTGATCATTTTTCAG
ATTGTGAATTTTTGGCTGCCTTGTATAATCCTTTTGGGAATTTTAAACCCCACTTACAAAAACTATGTGA
TGGTATCAACAAAATGTTGGATGAAGAGAACATA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG202729 representing NM_014350
Red=Cloning site Green=Tags(s)

MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEK
IIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLH
QIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014350
ORF Size 594 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014350.4
RefSeq Size 2015 bp
RefSeq ORF 597 bp
Locus ID 25816
UniProt ID O95379
Cytogenetics 5q23.1
Protein Families Druggable Genome
Summary Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:TNFAIP8 (NM_014350) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202729 TNFAIP8 (Myc-DDK-tagged)-Human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1 10 ug
$300.00
RC202729L1 Lenti ORF clone of Human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC202729L2 Lenti ORF clone of Human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1, mGFP tagged 10 ug
$600.00
RC202729L3 Lenti ORF clone of Human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC202729L4 Lenti ORF clone of Human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1, mGFP tagged 10 ug
$600.00
SC312385 TNFAIP8 (untagged)-Human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1 10 ug
$330.00
SC317294 TNFAIP8 (untagged)-Human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1 10 ug
$330.00
SC320774 TNFAIP8 (untagged)-Human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.