VKORC1 (NM_024006) Human Tagged ORF Clone

SKU
RG202639
VKORC1 (tGFP-tagged) - Human vitamin K epoxide reductase complex, subunit 1 (VKORC1), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol VKORC1
Synonyms EDTP308; MST134; MST576; VKCFD2; VKOR
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG202639 representing NM_024006
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCAGCACCTGGGGGAGCCCTGGCTGGGTGCGGCTCGCTCTTTGCCTGACGGGCTTAGTGCTCTCGC
TCTACGCGCTGCACGTGAAGGCGGCGCGCGCCCGGGACCGGGATTACCGCGCGCTCTGCGACGTGGGCAC
CGCCATCAGCTGTTCGCGCGTCTTCTCCTCCAGGTGGGGCAGGGGTTTCGGGCTGGTGGAGCATGTGCTG
GGACAGGACAGCATCCTCAATCAATCCAACAGCATATTCGGTTGCATCTTCTACACACTACAGCTATTGT
TAGGTTGCCTGCGGACACGCTGGGCCTCTGTCCTGATGCTGCTGAGCTCCCTGGTGTCTCTCGCTGGTTC
TGTCTACCTGGCCTGGATCCTGTTCTTCGTGCTCTATGATTTCTGCATTGTTTGTATCACCACCTATGCT
ATCAACGTGAGCCTGATGTGGCTCAGTTTCCGGAAGGTCCAAGAACCCCAGGGCAAGGCTAAGAGGCAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG202639 representing NM_024006
Red=Cloning site Green=Tags(s)

MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVL
GQDSILNQSNSIFGCIFYTLQLLLGCLRTRWASVLMLLSSLVSLAGSVYLAWILFFVLYDFCIVCITTYA
INVSLMWLSFRKVQEPQGKAKRH

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_024006
ORF Size 489 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024006.6
RefSeq Size 1042 bp
RefSeq ORF 492 bp
Locus ID 79001
UniProt ID Q9BQB6
Cytogenetics 16p11.2
Protein Families Transmembrane
Summary This gene encodes the catalytic subunit of the vitamin K epoxide reductase complex, which is responsible for the reduction of inactive vitamin K 2,3-epoxide to active vitamin K in the endoplasmic reticulum membrane. Vitamin K is a required co-factor for carboxylation of glutamic acid residues by vitamin K-dependent gamma-carboxylase in blood-clotting enzymes. Allelic variation in this gene is associated with vitamin k-dependent clotting factors combined deficiency of 2, and increased resistance or sensitivity to warfarin, an inhibitor of vitamin K epoxide reductase. Pseudogenes of this gene are located on chromosomes 1 and X. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015]
Write Your Own Review
You're reviewing:VKORC1 (NM_024006) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202639 VKORC1 (Myc-DDK-tagged)-Human vitamin K epoxide reductase complex, subunit 1 (VKORC1), transcript variant 1 10 ug
$150.00
RC202639L1 Lenti ORF clone of Human vitamin K epoxide reductase complex, subunit 1 (VKORC1), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC202639L2 Lenti ORF clone of Human vitamin K epoxide reductase complex, subunit 1 (VKORC1), transcript variant 1, mGFP tagged 10 ug
$450.00
RC202639L3 Lenti ORF clone of Human vitamin K epoxide reductase complex, subunit 1 (VKORC1), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC202639L4 Lenti ORF clone of Human vitamin K epoxide reductase complex, subunit 1 (VKORC1), transcript variant 1, mGFP tagged 10 ug
$450.00
SC112318 VKORC1 (untagged)-Human vitamin K epoxide reductase complex, subunit 1 (VKORC1), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.