TTC11 (FIS1) (NM_016068) Human Tagged ORF Clone

SKU
RG202560
FIS1 (tGFP-tagged) - Human fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) (FIS1), nuclear gene encoding mitochondrial protein
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TTC11
Synonyms CGI-135; TTC11
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG202560 representing NM_016068
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCCGTGCTGAACGAGCTGGTGTCTGTGGAGGACCTGCTGAAGTTTGAAAAGAAATTTCAGTCTG
AGAAGGCAGCAGGCTCGGTGTCCAAGAGCACGCAGTTTGAGTACGCCTGGTGCCTGGTGCGGAGCAAGTA
CAATGATGACATCCGTAAAGGCATCGTGCTGCTCGAGGAGCTGCTGCCCAAAGGGAGCAAGGAGGAACAG
CGGGATTACGTCTTCTACCTGGCCGTGGGGAACTACCGGCTCAAGGAATACGAGAAGGCCTTAAAGTACG
TCCGCGGGTTGCTGCAGACAGAGCCCCAGAACAACCAGGCCAAGGAACTGGAGCGGCTCATTGACAAGGC
CATGAAGAAAGATGGACTCGTGGGCATGGCCATCGTGGGAGGCATGGCCCTGGGTGTGGCGGGACTGGCC
GGACTCATCGGACTTGCTGTGTCCAAGTCCAAATCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG202560 representing NM_016068
Red=Cloning site Green=Tags(s)

MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQ
RDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLA
GLIGLAVSKSKS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016068
ORF Size 456 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016068.3
RefSeq Size 735 bp
RefSeq ORF 459 bp
Locus ID 51024
UniProt ID Q9Y3D6
Cytogenetics 7q22.1
Protein Families Transmembrane
Summary The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:TTC11 (FIS1) (NM_016068) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202560 FIS1 (Myc-DDK-tagged)-Human fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) (FIS1), nuclear gene encoding mitochondrial protein 10 ug
$289.00
RC202560L1 Lenti ORF clone of Human fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) (FIS1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$450.00
RC202560L2 Lenti ORF clone of Human fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) (FIS1), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$450.00
RC202560L3 Lenti ORF clone of Human fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) (FIS1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$450.00
RC202560L4 Lenti ORF clone of Human fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) (FIS1), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$450.00
SC108699 FIS1 (untagged)-Human fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) (FIS1), nuclear gene encoding mitochondrial protein 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.