Uteroglobin (SCGB1A1) (NM_003357) Human Tagged ORF Clone

SKU
RG202497
SCGB1A1 (tGFP-tagged) - Human secretoglobin, family 1A, member 1 (uteroglobin) (SCGB1A1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Uteroglobin
Synonyms CC10; CC16; CCPBP; CCSP; UGB; UP-1; UP1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG202497 representing NM_003357
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAACTCGCTGTCACCCTCACCCTGGTCACACTGGCTCTCTGCTGCAGCTCCGCTTCTGCAGAGATCT
GCCCGAGCTTTCAGCGTGTCATCGAAACCCTCCTCATGGACACACCCTCCAGTTATGAGGCTGCCATGGA
ACTTTTCAGCCCTGATCAAGACATGAGGGAGGCAGGGGCTCAGCTGAAGAAGCTGGTGGACACCCTCCCC
CAAAAGCCCAGAGAAAGCATCATTAAGCTCATGGAAAAAATAGCCCAAAGCTCACTGTGTAAT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG202497 representing NM_003357
Red=Cloning site Green=Tags(s)

MKLAVTLTLVTLALCCSSASAEICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGAQLKKLVDTLP
QKPRESIIKLMEKIAQSSLCN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003357
ORF Size 273 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003357.5
RefSeq Size 472 bp
RefSeq ORF 276 bp
Locus ID 7356
UniProt ID P11684
Cytogenetics 11q12.3
Protein Families Druggable Genome, Secreted Protein
Summary This gene encodes a member of the secretoglobin family of small secreted proteins. The encoded protein has been implicated in numerous functions including anti-inflammation, inhibition of phospholipase A2 and the sequestering of hydrophobic ligands. Defects in this gene are associated with a susceptibility to asthma. [provided by RefSeq, May 2010]
Write Your Own Review
You're reviewing:Uteroglobin (SCGB1A1) (NM_003357) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202497 SCGB1A1 (Myc-DDK-tagged)-Human secretoglobin, family 1A, member 1 (uteroglobin) (SCGB1A1) 10 ug
$150.00
RC202497L1 Lenti ORF clone of Human secretoglobin, family 1A, member 1 (uteroglobin) (SCGB1A1), Myc-DDK-tagged 10 ug
$450.00
RC202497L2 Lenti ORF clone of Human secretoglobin, family 1A, member 1 (uteroglobin) (SCGB1A1), mGFP tagged 10 ug
$450.00
RC202497L3 Lenti ORF clone of Human secretoglobin, family 1A, member 1 (uteroglobin) (SCGB1A1), Myc-DDK-tagged 10 ug
$450.00
RC202497L4 Lenti ORF clone of Human secretoglobin, family 1A, member 1 (uteroglobin) (SCGB1A1), mGFP tagged 10 ug
$450.00
SC122655 SCGB1A1 (untagged)-Human secretoglobin, family 1A, member 1 (uteroglobin) (SCGB1A1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.