ID1 (NM_002165) Human Tagged ORF Clone

SKU
RG202061
ID1 (tGFP-tagged) - Human inhibitor of DNA binding 1, dominant negative helix-loop-helix protein (ID1), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$425.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ID1
Synonyms bHLHb24; ID
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG202061 representing NM_002165
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAAGTCGCCAGTGGCAGCACCGCCACCGCCGCCGCGGGCCCCAGCTGCGCGCTGAAGGCCGGCAAGA
CAGCGAGCGGTGCGGGCGAGGTGGTGCGCTGTCTGTCTGAGCAGAGCGTGGCCATCTCGCGCTGCGCCGG
GGGCGCCGGGGCGCGCCTGCCTGCCCTGCTGGACGAGCAGCAGGTAAACGTGCTGCTCTACGACATGAAC
GGCTGTTACTCACGCCTCAAGGAGCTGGTGCCCACCCTGCCCCAGAACCGCAAGGTGAGCAAGGTGGAGA
TTCTCCAGCACGTCATCGACTACATCAGGGACCTTCAGTTGGAGCTGAACTCGGAATCCGAAGTTGGAAC
CCCCGGGGGCCGAGGGCTGCCGGTCCGGGCTCCGCTCAGCACCCTCAACGGCGAGATCAGCGCCCTGACG
GCCGAGGCGGCATGCGTTCCTGCGGACGATCGCATCTTGTGTCGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG202061 representing NM_002165
Red=Cloning site Green=Tags(s)

MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMN
GCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALT
AEAACVPADDRILCR

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002165
ORF Size 465 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002165.4
RefSeq Size 993 bp
RefSeq ORF 468 bp
Locus ID 3397
UniProt ID P41134
Cytogenetics 20q11.21
Domains HLH
Protein Families Druggable Genome, Transcription Factors
Protein Pathways TGF-beta signaling pathway
Summary The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:ID1 (NM_002165) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202061 ID1 (Myc-DDK-tagged)-Human inhibitor of DNA binding 1, dominant negative helix-loop-helix protein (ID1), transcript variant 1 10 ug
$225.00
RC202061L1 Lenti ORF clone of Human inhibitor of DNA binding 1, dominant negative helix-loop-helix protein (ID1), transcript variant 1, Myc-DDK-tagged 10 ug
$525.00
RC202061L2 Lenti ORF clone of Human inhibitor of DNA binding 1, dominant negative helix-loop-helix protein (ID1), transcript variant 1, mGFP tagged 10 ug
$525.00
RC202061L3 Lenti ORF clone of Human inhibitor of DNA binding 1, dominant negative helix-loop-helix protein (ID1), transcript variant 1, Myc-DDK-tagged 10 ug
$525.00
RC202061L4 Lenti ORF clone of Human inhibitor of DNA binding 1, dominant negative helix-loop-helix protein (ID1), transcript variant 1, mGFP tagged 10 ug
$525.00
SC125462 ID1 (untagged)-Human inhibitor of DNA binding 1, dominant negative helix-loop-helix protein (ID1), transcript variant 1 10 ug
$225.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.