GRO alpha (CXCL1) (NM_001511) Human Tagged ORF Clone

SKU
RG201992
CXCL1 (tGFP-tagged) - Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$425.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GRO alpha
Synonyms FSP; GRO1; GROa; MGSA; MGSA-a; NAP-3; SCYB1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201992 representing NM_001511
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCGCGCTGCTCTCTCCGCCGCCCCCAGCAATCCCCGGCTCCTGCGAGTGGCACTGCTGCTCCTGC
TCCTGGTAGCCGCTGGCCGGCGCGCAGCAGGAGCGTCCGTGGCCACTGAACTGCGCTGCCAGTGCTTGCA
GACCCTGCAGGGAATTCACCCCAAGAACATCCAAAGTGTGAACGTGAAGTCCCCCGGACCCCACTGCGCC
CAAACCGAAGTCATAGCCACACTCAAGAATGGGCGGAAAGCTTGCCTCAATCCTGCATCCCCCATAGTTA
AGAAAATCATCGAAAAGATGCTGAACAGTGACAAATCCAAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201992 representing NM_001511
Red=Cloning site Green=Tags(s)

MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCA
QTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001511
ORF Size 321 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001511.4
RefSeq Size 1103 bp
RefSeq ORF 324 bp
Locus ID 2919
UniProt ID P09341
Cytogenetics 4q13.3
Domains IL8
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Epithelial cell signaling in Helicobacter pylori infection, NOD-like receptor signaling pathway
Summary This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. Aberrant expression of this protein is associated with the growth and progression of certain tumors. A naturally occurring processed form of this protein has increased chemotactic activity. Alternate splicing results in coding and non-coding variants of this gene. A pseudogene of this gene is found on chromosome 4. [provided by RefSeq, Sep 2014]
Write Your Own Review
You're reviewing:GRO alpha (CXCL1) (NM_001511) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201992 CXCL1 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1) 10 ug
$225.00
RC201992L1 Lenti ORF clone of Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1), Myc-DDK-tagged 10 ug
$525.00
RC201992L2 Lenti ORF clone of Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1), mGFP tagged 10 ug
$525.00
RC201992L3 Lenti ORF clone of Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1), Myc-DDK-tagged 10 ug
$525.00
RC201992L4 Lenti ORF clone of Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1), mGFP tagged 10 ug
$525.00
SC119178 CXCL1 (untagged)-Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1) 10 ug
$225.00
SC322326 CXCL1 (untagged)-Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1) 10 ug
$225.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.