RALB (NM_002881) Human Tagged ORF Clone

SKU
RG201982
RALB (tGFP-tagged) - Human v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (RALB)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RALB
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201982 representing NM_002881
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCCAACAAGAGTAAGGGCCAGAGCTCCTTGGCCCTCCACAAGGTGATCATGGTTGGCAGCGGAG
GCGTTGGCAAGTCAGCCCTGACGCTTCAGTTCATGTATGACGAGTTTGTAGAAGACTATGAACCTACCAA
AGCTGACAGTTATAGAAAGAAAGTGGTTCTTGATGGGGAAGAAGTTCAGATAGATATTCTGGACACCGCT
GGGCAAGAGGACTACGCAGCCATTCGAGATAACTACTTTCGGAGTGGGGAAGGGTTTCTTCTTGTGTTCT
CAATCACAGAACATGAATCCTTTACAGCAACTGCCGAATTCAGGGAACAGATTCTCCGTGTGAAGGCTGA
AGAAGATAAAATTCCACTGCTCGTCGTGGGAAACAAGTCTGACCTAGAGGAGCGGAGGCAGGTGCCTGTG
GAGGAGGCCAGGAGTAAAGCCGAAGAGTGGGGCGTGCAGTACGTGGAGACGTCAGCGAAGACCCGGGCCA
ACGTGGACAAGGTGTTCTTTGACCTAATGAGAGAAATCAGAACAAAGAAGATGTCAGAAAACAAAGACAA
GAATGGCAAGAAAAGCAGCAAGAACAAGAAAAGTTTTAAAGAAAGATGTTGCTTACTA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201982 representing NM_002881
Red=Cloning site Green=Tags(s)

MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA
GQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPV
EEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002881
ORF Size 618 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002881.3
RefSeq Size 2275 bp
RefSeq ORF 621 bp
Locus ID 5899
UniProt ID P11234
Cytogenetics 2q14.2
Domains RAB, RAN, ras, RAS, RHO
Protein Families Druggable Genome
Protein Pathways Pancreatic cancer, Pathways in cancer
Summary This gene encodes a GTP-binding protein that belongs to the small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:RALB (NM_002881) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201982 RALB (Myc-DDK-tagged)-Human v-ral simian leukemia viral oncogene homolog B (ras related, GTP binding protein) (RALB) 10 ug
$300.00
RC201982L1 Lenti ORF clone of Human v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (RALB), Myc-DDK-tagged 10 ug
$600.00
RC201982L2 Lenti ORF clone of Human v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (RALB), mGFP tagged 10 ug
$600.00
RC201982L3 Lenti ORF clone of Human v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (RALB), Myc-DDK-tagged 10 ug
$600.00
RC201982L4 Lenti ORF clone of Human v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (RALB), mGFP tagged 10 ug
$600.00
SC118324 RALB (untagged)-Human v-ral simian leukemia viral oncogene homolog B (ras related, GTP binding protein) (RALB) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.