Calcium binding protein P22 (CHP1) (NM_007236) Human Tagged ORF Clone

SKU
RG201928
CHP1 (tGFP-tagged) - Human calcium binding protein P22 (CHP)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Calcium binding protein P22
Synonyms CHP; p22; p24; Sid470p; SLC9A1BP; SPAX9
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201928 representing NM_007236
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTTCTCGGGCCTCCACGTTACTGCGGGACGAAGAGCTCGAGGAGATCAAGAAGGAGACCGGCTTTT
CCCACAGTCAAATCACTCGCCTCTACAGCCGGTTCACCAGCCTGGACAAAGGAGAGAATGGGACTCTCAG
CCGGGAAGATTTCCAGAGGATTCCAGAACTTGCCATCAACCCACTGGGGGACCGGATCATCAATGCCTTC
TTTCCAGAGGGAGAGGACCAGGTAAACTTCCGTGGATTCATGCGAACTTTGGCTCATTTCCGCCCCATTG
AGGATAATGAAAAGAGCAAAGATGTGAATGGACCCGAACCACTCAACAGCCGAAGCAACAAACTGCACTT
TGCTTTTCGACTATATGATTTGGATAAAGATGAAAAGATCTCCCGTGATGAGCTGTTACAGGTGCTACGC
ATGATGGTCGGAGTAAATATCTCAGATGAGCAGCTGGGCAGCATCGCAGACAGGACCATTCAGGAGGCTG
ATCAGGATGGGGACAGTGCCATATCTTTCACAGAATTTGTTAAGGTTTTGGAGAAGGTGGATGTAGAACA
GAAAATGAGCATCCGATTTCTTCAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201928 representing NM_007236
Red=Cloning site Green=Tags(s)

MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAF
FPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLR
MMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_007236
ORF Size 585 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007236.5
RefSeq Size 3248 bp
RefSeq ORF 588 bp
Locus ID 11261
UniProt ID Q99653
Cytogenetics 15q15.1
Domains EFh
Protein Pathways Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Axon guidance, B cell receptor signaling pathway, Calcium signaling pathway, Long-term potentiation, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Oocyte meiosis, T cell receptor signaling pathway, VEGF signaling pathway, Wnt signaling pathway
Summary This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Calcium binding protein P22 (CHP1) (NM_007236) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201928 CHP1 (Myc-DDK-tagged)-Human calcium binding protein P22 (CHP) 10 ug
$300.00
RC201928L1 Lenti ORF clone of Human calcium binding protein P22 (CHP), Myc-DDK-tagged 10 ug
$600.00
RC201928L2 Lenti ORF clone of Human calcium binding protein P22 (CHP), mGFP tagged 10 ug
$600.00
RC201928L3 Lenti ORF clone of Human calcium binding protein P22 (CHP), Myc-DDK-tagged 10 ug
$600.00
RC201928L4 Lenti ORF clone of Human calcium binding protein P22 (CHP), mGFP tagged 10 ug
$600.00
SC125497 CHP1 (untagged)-Human calcium binding protein P22 (CHP) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.