C20orf30 (TMEM230) (NM_014145) Human Tagged ORF Clone

SKU
RG201878
TMEM230 (tGFP-tagged) - Human chromosome 20 open reading frame 30 (C20orf30), transcript variant 3
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol C20orf30
Synonyms C20orf30; dJ1116H23.2.1; HSPC274
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201878 representing NM_014145
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGCCGTCCCGTACCAACCTGGCTACTGGAATCCCCAGTAGTAAAGTGAAATATTCAAGGCTCTCCA
GCACAGACGATGGCTACATTGACCTTCAGTTTAAGAAAACCCCTCCTAAGATCCCTTATAAGGCCATCGC
ACTTGCCACTGTGCTGTTTTTGATTGGCGCCTTTCTCATTATTATAGGCTCCCTCCTGCTGTCAGGCTAC
ATCAGCAAAGGGGGGGCAGACCGGGCCGTTCCAGTGCTGATCATTGGCATTCTGGTGTTCCTACCCGGAT
TTTACCACCTGCGCATCGCTTACTATGCATCCAAAGGCTACCGTGCTTACTCCTATGATGACATTCCAGA
CTTTGATGAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201878 representing NM_014145
Red=Cloning site Green=Tags(s)

MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGY
ISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRAYSYDDIPDFDD

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014145
ORF Size 360 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014145.2
RefSeq Size 1699 bp
RefSeq ORF 363 bp
Locus ID 29058
UniProt ID Q96A57
Cytogenetics 20p13-p12.3
Protein Families Transmembrane
Summary This gene encodes a multi-pass transmembrane protein that belongs to the TMEM134/TMEM230 protein family. The encoded protein localizes to secretory and recycling vesicle in the neuron and may be involved in synaptic vesicles trafficking and recycling. Mutations in this gene may be linked to familial Parkinson's disease. [provided by RefSeq, Mar 2017]
Write Your Own Review
You're reviewing:C20orf30 (TMEM230) (NM_014145) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201878 TMEM230 (Myc-DDK-tagged)-Human chromosome 20 open reading frame 30 (C20orf30), transcript variant 3 10 ug
$150.00
RC201878L3 Lenti ORF clone of Human chromosome 20 open reading frame 30 (C20orf30), transcript variant 3, Myc-DDK-tagged 10 ug
$450.00
RC201878L4 Lenti ORF clone of Human chromosome 20 open reading frame 30 (C20orf30), transcript variant 3, mGFP tagged 10 ug
$450.00
SC115169 TMEM230 (untagged)-Human chromosome 20 open reading frame 30 (C20orf30), transcript variant 3 10 ug
$150.00
SC322333 TMEM230 (untagged)-Human chromosome 20 open reading frame 30 (C20orf30), transcript variant 3 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.