TPD52L1 (NM_001003396) Human Tagged ORF Clone

SKU
RG201816
TPD52L1 (tGFP-tagged) - Human tumor protein D52-like 1 (TPD52L1), transcript variant 3
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TPD52L1
Synonyms D53; TPD53
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201816 representing NM_001003396
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCGCAGGCACAAGGTTTGTTGGAGACTGAACCGTTGCAAGGAACAGACGAAGATGCAGTAGCCA
GTGCTGACTTCTCTAGCATGCTCTCTGAGGAGGAAAAGGAAGAGTTAAAAGCAGAGTTAGTTCAGCTAGA
AGACGAAATTACAACACTACGACAAGTTTTGTCAGCGAAAGAAAGGCATCTAGTTGAGATAAAACAAAAA
CTCGGCATGAACCTGATGAATGAATTAAAACAGAACTTCAGCAAAAGCTGGCATGACATGCAGACTACCA
CTGCCTACAAGAAAACACATGAAACCCTGAGTCACGCAGGGCAAAAGGCAACTGCAGCTTTCAGCAACGT
TGGAACGGCCATCAGCAAGAAGTTCGGAGACATGAGTTACTCCATTCGCCATTCCATAAGTATGCCTGCT
ATGAGACGAAAG


AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201816 representing NM_001003396
Red=Cloning site Green=Tags(s)

MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQK
LGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPA
MRRK

SGPTRTRRLE - GFP Tag - V
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_001003396
ORF Size 432 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001003396.3
RefSeq Size 1327 bp
RefSeq ORF 435 bp
Locus ID 7164
UniProt ID Q16890
Cytogenetics 6q22.31
Summary This gene encodes a member of a family of proteins that contain coiled-coil domains and may form hetero- or homomers. The encoded protein is involved in cell proliferation and calcium signaling. It also interacts with the mitogen-activated protein kinase kinase kinase 5 (MAP3K5/ASK1) and positively regulates MAP3K5-induced apoptosis. Multiple alternatively spliced transcript variants have been observed. [provided by RefSeq, Jan 2016]
Write Your Own Review
You're reviewing:TPD52L1 (NM_001003396) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201816 TPD52L1 (Myc-DDK-tagged)-Human tumor protein D52-like 1 (TPD52L1), transcript variant 3 10 ug
$150.00
RC201816L3 Lenti ORF clone of Human tumor protein D52-like 1 (TPD52L1), transcript variant 3, Myc-DDK-tagged 10 ug
$450.00
RC201816L4 Lenti ORF clone of Human tumor protein D52-like 1 (TPD52L1), transcript variant 3, mGFP tagged 10 ug
$450.00
SC124319 TPD52L1 (untagged)-Human tumor protein D52-like 1 (TPD52L1), transcript variant 3 10 ug
$150.00
SC320590 TPD52L1 (untagged)-Human tumor protein D52-like 1 (TPD52L1), transcript variant 3 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.