COX7C (NM_001867) Human Tagged ORF Clone

SKU
RG201768
COX7C (tGFP-tagged) - Human cytochrome c oxidase subunit VIIc (COX7C), nuclear gene encoding mitochondrial protein
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol COX7C
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201768 representing NM_001867
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGGGCCAGAGCATCCGGAGGTTCACAACCTCTGTGGTCCGTAGGAGCCACTATGAGGAGGGCCCTG
GGAAGAATTTGCCATTTTCAGTGGAAAACAAGTGGTCGTTACTAGCTAAGATGTGTTTGTACTTTGGATC
TGCATTTGCTACACCCTTCCTTGTAGTAAGACACCAACTGCTTAAAACA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201768 representing NM_001867
Red=Cloning site Green=Tags(s)

MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001867
ORF Size 189 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001867.3
RefSeq Size 448 bp
RefSeq ORF 192 bp
Locus ID 1350
UniProt ID P15954
Cytogenetics 5q14.3
Protein Pathways Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
Summary Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes subunit VIIc, which shares 87% and 85% amino acid sequence identity with mouse and bovine COX VIIc, respectively, and is found in all tissues. A pseudogene COX7CP1 has been found on chromosome 13. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:COX7C (NM_001867) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201768 COX7C (Myc-DDK-tagged)-Human cytochrome c oxidase subunit VIIc (COX7C), nuclear gene encoding mitochondrial protein 10 ug
$150.00
RC201768L3 Lenti ORF clone of Human cytochrome c oxidase subunit VIIc (COX7C), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$450.00
RC201768L4 Lenti ORF clone of Human cytochrome c oxidase subunit VIIc (COX7C), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$450.00
SC118992 COX7C (untagged)-Human cytochrome c oxidase subunit VIIc (COX7C), nuclear gene encoding mitochondrial protein 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.