HMGN4 (NM_006353) Human Tagged ORF Clone

SKU
RG201589
HMGN4 (tGFP-tagged) - Human high mobility group nucleosomal binding domain 4 (HMGN4)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HMGN4
Synonyms HMG17L3; NHC
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201589 representing NM_006353
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCAAGAGAAAGGCAAAAGGAGATGCTAAAGGTGATAAAGCAAAGGTGAAGGATGAGCCACAGAGGA
GATCAGCTCGGTTGTCTGCTAAACCAGCTCCTCCAAAACCAGAGCCCAGGCCTAAAAAGGCCTCTGCAAA
GAAGGGAGAGAAGCTTCCCAAAGGGAGAAAGGGGAAAGCAGATGCTGGAAAGGATGGAAACAACCCTGCA
AAAAACCGAGATGCCTCTACACTCCAGTCCCAGAAAGCGGAAGGCACTGGGGATGCCAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201589 representing NM_006353
Red=Cloning site Green=Tags(s)

MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPA
KNRDASTLQSQKAEGTGDAK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006353
ORF Size 270 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006353.1, NP_006344.1
RefSeq Size 1980 bp
RefSeq ORF 273 bp
Locus ID 10473
UniProt ID O00479
Cytogenetics 6p22.2
Summary The protein encoded by this gene, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. [provided by RefSeq, Mar 2013]
Write Your Own Review
You're reviewing:HMGN4 (NM_006353) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201589 HMGN4 (Myc-DDK-tagged)-Human high mobility group nucleosomal binding domain 4 (HMGN4) 10 ug
$150.00
RC201589L1 Lenti ORF clone of Human high mobility group nucleosomal binding domain 4 (HMGN4), Myc-DDK-tagged 10 ug
$450.00
RC201589L2 Lenti ORF clone of Human high mobility group nucleosomal binding domain 4 (HMGN4), mGFP tagged 10 ug
$450.00
RC201589L3 Lenti ORF clone of Human high mobility group nucleosomal binding domain 4 (HMGN4), Myc-DDK-tagged 10 ug
$450.00
RC201589L4 Lenti ORF clone of Human high mobility group nucleosomal binding domain 4 (HMGN4), mGFP tagged 10 ug
$450.00
SC116141 HMGN4 (untagged)-Human high mobility group nucleosomal binding domain 4 (HMGN4) 10 ug
$614.00
SC322195 HMGN4 (untagged)-Human high mobility group nucleosomal binding domain 4 (HMGN4) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.