RAB13 (NM_002870) Human Tagged ORF Clone

SKU
RG201555
RAB13 (tGFP-tagged) - Human RAB13, member RAS oncogene family (RAB13)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RAB13
Synonyms GIG4
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201555 representing NM_002870
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAAAGCCTACGACCACCTCTTCAAGTTGCTGCTGATCGGGGACTCGGGGGTGGGCAAGACTTGTC
TGATCATTCGCTTTGCAGAGGACAACTTCAACAACACTTACATCTCCACCATCGGAATTGATTTCAAGAT
CCGCACTGTGGATATAGAGGGGAAGAAGATCAAACTACAAGTCTGGGACACGGCTGGCCAAGAGCGGTTC
AAGACAATAACTACTGCCTACTACCGTGGAGCCATGGGCATTATCCTAGTATACGACATCACGGATGAGA
AATCTTTCGAGAATATTCAGAACTGGATGAAAAGCATCAAGGAGAATGCCTCGGCTGGGGTGGAGCGCCT
CTTGCTGGGGAACAAATGTGACATGGAGGCCAAGAGGAAGGTGCAGAAGGAGCAGGCCGATAAGTTGGCT
CGAGAGCATGGAATCCGATTTTTCGAAACTAGTGCTAAATCCAGTATGAATGTGGATGAGGCTTTTAGTT
CCCTGGCCCGGGACATCTTGCTCAAGTCAGGAGGCCGGAGATCAGGAAACGGCAACAAGCCTCCCAGTAC
TGACCTGAAAACTTGTGACAAGAAGAACACCAACAAGTGCTCCCTGGGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201555 representing NM_002870
Red=Cloning site Green=Tags(s)

MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERF
KTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLA
REHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGNGNKPPSTDLKTCDKKNTNKCSLG

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002870
ORF Size 609 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002870.5
RefSeq Size 1211 bp
RefSeq ORF 612 bp
Locus ID 5872
UniProt ID P51153
Cytogenetics 1q21.3
Domains ARF, RAB, RAN, ras, RAS, RHO
Protein Families Druggable Genome
Protein Pathways Tight junction
Summary This gene is a member of the Rab family of small G proteins and plays a role in regulating membrane trafficking between trans-Golgi network (TGN) and recycling endosomes (RE). The encoded protein is involved in the assembly of tight junctions, which are components of the apical junctional complex (AJC) of epithelial cells. The AJC plays a role in forming a barrier between luminal contents and the underlying tissue. Additional functions associated with the protein include endocytic recycling of occludin, regulation of epithelial cell scattering, neuronal regeneration and regulation of neurite outgrowth. Alternately spliced transcript variants have been observed for this gene. A pseudogene associated with this gene is located on chromosome 12. [provided by RefSeq, Jan 2013]
Write Your Own Review
You're reviewing:RAB13 (NM_002870) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201555 RAB13 (Myc-DDK-tagged)-Human RAB13, member RAS oncogene family (RAB13) 10 ug
$300.00
RC201555L1 Lenti ORF clone of Human RAB13, member RAS oncogene family (RAB13), Myc-DDK-tagged 10 ug
$600.00
RC201555L2 Lenti ORF clone of Human RAB13, member RAS oncogene family (RAB13), mGFP tagged 10 ug
$600.00
RC201555L3 Lenti ORF clone of Human RAB13, member RAS oncogene family (RAB13), Myc-DDK-tagged 10 ug
$600.00
RC201555L4 Lenti ORF clone of Human RAB13, member RAS oncogene family (RAB13), mGFP tagged 10 ug
$600.00
SC118356 RAB13 (untagged)-Human RAB13, member RAS oncogene family (RAB13) 10 ug
$300.00
SC322199 RAB13 (untagged)-Human RAB13, member RAS oncogene family (RAB13) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.