PPIH (NM_006347) Human Tagged ORF Clone

SKU
RG201529
PPIH (tGFP-tagged) - Human peptidylprolyl isomerase H (cyclophilin H) (PPIH)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PPIH
Synonyms CYP-20; CYPH; SnuCyp-20; USA-CYP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201529 representing NM_006347
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGTGGCAAATTCAAGTCCTGTTAACCCCGTGGTGTTCTTTGATGTCAGTATTGGCGGTCAGGAAG
TTGGCCGCATGAAGATCGAGCTCTTTGCAGACGTTGTGCCTAAGACGGCCGAGAACTTTAGGCAGTTCTG
CACCGGAGAATTCAGGAAAGATGGGGTTCCAATAGGATACAAAGGAAGCACCTTCCACAGGGTCATAAAG
GATTTCATGATTCAGGGTGGAGATTTTGTTAATGGAGATGGTACTGGAGTCGCCAGTATTTACCGGGGGC
CATTTGCAGATGAAAATTTTAAACTTAGACACTCAGCTCCAGGCCTGCTTTCCATGGCGAACAGTGGTCC
AAGTACAAATGGCTGTCAGTTCTTTATCACCTGCTCTAAGTGCGATTGGCTGGATGGGAAGCATGTGGTG
TTTGGAAAAATCATCGATGGACTTCTAGTGATGAGAAAGATTGAGAATGTTCCCACAGGCCCCAACAATA
AGCCCAAGCTACCTGTGGTGATCTCGCAGTGTGGGGAGATG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201529 representing NM_006347
Red=Cloning site Green=Tags(s)

MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIK
DFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVV
FGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006347
ORF Size 531 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006347.4
RefSeq Size 813 bp
RefSeq ORF 534 bp
Locus ID 10465
UniProt ID O43447
Cytogenetics 1p34.2
Domains pro_isomerase
Protein Pathways Spliceosome
Summary The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:PPIH (NM_006347) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201529 PPIH (Myc-DDK-tagged)-Human peptidylprolyl isomerase H (cyclophilin H) (PPIH) 10 ug
$300.00
RC201529L1 Lenti ORF clone of Human peptidylprolyl isomerase H (cyclophilin H) (PPIH), Myc-DDK-tagged 10 ug
$600.00
RC201529L2 Lenti ORF clone of Human peptidylprolyl isomerase H (cyclophilin H) (PPIH), mGFP tagged 10 ug
$600.00
RC201529L3 Lenti ORF clone of Human peptidylprolyl isomerase H (cyclophilin H) (PPIH), Myc-DDK-tagged 10 ug
$600.00
RC201529L4 Lenti ORF clone of Human peptidylprolyl isomerase H (cyclophilin H) (PPIH), mGFP tagged 10 ug
$600.00
SC116136 PPIH (untagged)-Human peptidylprolyl isomerase H (cyclophilin H) (PPIH) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.