NOLA1 (GAR1) (NM_018983) Human Tagged ORF Clone

SKU
RG201481
GAR1 (tGFP-tagged) - Human GAR1 ribonucleoprotein homolog (yeast) (GAR1), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NOLA1
Synonyms NOLA1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201481 representing NM_018983
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTTTTCGAGGCGGAGGTCGTGGAGGCTTTAATCGAGGTGGTGGAGGTGGCGGCTTCAACCGAGGCG
GCAGCAGCAACCACTTCCGAGGTGGAGGCGGCGGTGGAGGCGGCGGCAATTTCAGAGGCGGCGGCAGGGG
AGGATTTGGACGAGGGGGTGGCCGCGGAGGCTTTAACAAAGGCCAAGACCAAGGACCTCCAGAACGTGTA
GTCTTATTAGGAGAGTTCCTGCATCCCTGTGAAGATGACATAGTTTGTAAATGTACCACAGATGAAAATA
AGGTGCCTTATTTCAATGCTCCTGTTTACTTAGAAAACAAAGAACAAATTGGAAAAGTGGATGAAATATT
TGGACAACTCAGAGATTTTTATTTTTCAGTTAAGTTGTCAGAAAACATGAAGGCTTCATCCTTTAAAAAA
CTACAGAAGTTTTATATAGACCCATATAAGCTGCTGCCACTGCAGAGGTTTTTACCTCGACCTCCAGGTG
AGAAAGGACCTCCAAGAGGTGGTGGCAGGGGAGGCCGAGGAGGAGGAAGAGGAGGAGGTGGCAGAGGTGG
TGGCAGAGGTGGTGGTTTTAGAGGTGGAAGAGGAGGTGGAGGTGGGGGCTTCAGAGGAGGAAGAGGTGGT
GGTTTCAGAGGGAGAGGACAT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201481 representing NM_018983
Red=Cloning site Green=Tags(s)

MSFRGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKGQDQGPPERV
VLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKK
LQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGG
GFRGRGH

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018983
ORF Size 651 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018983.3, NP_061856.1
RefSeq Size 1280 bp
RefSeq ORF 654 bp
Locus ID 54433
UniProt ID Q9NY12
Cytogenetics 4q25
Domains Gar1
Protein Families Stem cell - Pluripotency
Summary This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA2 and NOLA3 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. These four H/ACA snoRNP proteins are also components of the telomerase complex. The encoded protein of this gene contains two glycine- and arginine-rich domains and is related to Saccharomyces cerevisiae Gar1p. Two splice variants have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:NOLA1 (GAR1) (NM_018983) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201481 GAR1 (Myc-DDK-tagged)-Human GAR1 ribonucleoprotein homolog (yeast) (GAR1), transcript variant 1 10 ug
$289.00 MSRP $300.00 MSRP $300.00
RC201481L3 Lenti ORF clone of Human GAR1 ribonucleoprotein homolog (yeast) (GAR1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC201481L4 Lenti ORF clone of Human GAR1 ribonucleoprotein homolog (yeast) (GAR1), transcript variant 1, mGFP tagged 10 ug
$600.00
SC111294 GAR1 (untagged)-Human GAR1 ribonucleoprotein homolog (yeast) (GAR1), transcript variant 1 10 ug
$300.00
SC322211 GAR1 (untagged)-Human GAR1 ribonucleoprotein homolog (yeast) (GAR1), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.