CD151 (NM_004357) Human Tagged ORF Clone

SKU
RG201383
CD151 (tGFP-tagged) - Human CD151 molecule (Raph blood group) (CD151), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CD151
Synonyms GP27; MER2; PETA-3; RAPH; SFA1; TSPAN24
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201383 representing NM_004357
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTGAGTTCAACGAGAAGAAGACAACATGTGGCACCGTTTGCCTCAAGTACCTGCTGTTTACCTACA
ATTGCTGCTTCTGGCTGGCTGGCCTGGCTGTCATGGCAGTGGGCATCTGGACGCTGGCCCTCAAGAGTGA
CTACATCAGCCTGCTGGCCTCAGGCACCTACCTGGCCACAGCCTACATCCTGGTGGTGGCGGGCACTGTC
GTCATGGTGACTGGGGTCTTGGGCTGCTGCGCCACCTTCAAGGAGCGTCGGAACCTGCTGCGCCTGTACT
TCATCCTGCTCCTCATCATCTTTCTGCTGGAGATCATCGCTGGTATCCTCGCCTACGCCTACTACCAGCA
GCTGAACACGGAGCTCAAGGAGAACCTGAAGGACACCATGACCAAGCGCTACCACCAGCCGGGCCATGAG
GCTGTGACCAGCGCTGTGGACCAGCTGCAGCAGGAGTTCCACTGCTGTGGCAGCAACAACTCACAGGACT
GGCGAGACAGTGAGTGGATCCGCTCACAGGAGGCCGGTGGCCGTGTGGTCCCAGACAGCTGCTGCAAGAC
GGTGGTGGCTCTTTGTGGACAGCGAGACCATGCCTCCAACATCTACAAGGTGGAGGGCGGCTGCATCACC
AAGTTGGAGACCTTCATCCAGGAGCACCTGAGGGTCATTGGGGCTGTGGGGATCGGCATTGCCTGTGTGC
AGGTCTTTGGCATGATCTTCACGTGCTGCCTGTACAGGAGTCTCAAGCTGGAGCACTAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201383 representing NM_004357
Red=Cloning site Green=Tags(s)

MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTV
VMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHE
AVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCIT
KLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004357
ORF Size 759 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004357.3, NP_004348.2
RefSeq Size 1574 bp
RefSeq ORF 762 bp
Locus ID 977
UniProt ID P48509
Cytogenetics 11p15.5
Domains transmembrane4
Protein Families Druggable Genome, Transmembrane
Summary The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. This protein enhances cell motility, invasion and metastasis of cancer cells. Multiple alternatively spliced transcript variants that encode the same protein have been described for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CD151 (NM_004357) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201383 CD151 (Myc-DDK-tagged)-Human CD151 molecule (Raph blood group) (CD151), transcript variant 1 10 ug
$300.00
RC201383L1 Lenti ORF clone of Human CD151 molecule (Raph blood group) (CD151), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC201383L2 Lenti ORF clone of Human CD151 molecule (Raph blood group) (CD151), transcript variant 1, mGFP tagged 10 ug
$600.00
RC201383L3 Lenti ORF clone of Human CD151 molecule (Raph blood group) (CD151), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC201383L4 Lenti ORF clone of Human CD151 molecule (Raph blood group) (CD151), transcript variant 1, mGFP tagged 10 ug
$600.00
SC319271 CD151 (untagged)-Human CD151 molecule (Raph blood group) (CD151), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.