MALL (NM_005434) Human Tagged ORF Clone

SKU
RG201378
MALL (tGFP-tagged) - Human mal, T-cell differentiation protein-like (MALL)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MALL
Synonyms BENE
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201378 representing NM_005434
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTCGCCCGACCCGCCCGCCACCAGCTACGCCCCGTCCGACGTGCCCTCGGGGGTCGCGCTGTTCC
TCACCATCCCTTTCGCCTTCTTCCTGCCCGAGCTGATATTTGGGTTCTTGGTCTGGACCATGGTAGCCGC
CACCCACATAGTATACCCCTTGCTGCAAGGATGGGTGATGTATGTCTCGCTCACCTCGTTTCTCATCTCC
TTGATGTTCCTGTTGTCTTACTTGTTTGGATTTTACAAAAGATTTGAATCCTGGAGAGTTCTGGACAGCC
TGTACCACGGGACCACTGGCATCCTGTACATGAGCGCTGCCGTCCTACAAGTACATGCCACGATTGTTTC
TGAGAAACTGCTGGACCCAAGAATTTACTACATTAATTCGGCAGCCTCGTTCTTCGCCTTCATCGCCACG
CTGCTCTACATTCTCCATGCCTTCAGCATCTATTACCAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201378 representing NM_005434
Red=Cloning site Green=Tags(s)

MASPDPPATSYAPSDVPSGVALFLTIPFAFFLPELIFGFLVWTMVAATHIVYPLLQGWVMYVSLTSFLIS
LMFLLSYLFGFYKRFESWRVLDSLYHGTTGILYMSAAVLQVHATIVSEKLLDPRIYYINSAASFFAFIAT
LLYILHAFSIYYH

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005434
ORF Size 459 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005434.5
RefSeq Size 2575 bp
RefSeq ORF 462 bp
Locus ID 7851
UniProt ID Q13021
Cytogenetics 2q13
Protein Families Transmembrane
Summary This gene encodes an element of the machinery for raft-mediated trafficking in endothelial cells. The encoded protein, a member of the MAL proteolipid family, predominantly localizes in glycolipid- and cholesterol-enriched membrane (GEM) rafts. It interacts with caveolin-1. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:MALL (NM_005434) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201378 MALL (Myc-DDK-tagged)-Human mal, T-cell differentiation protein-like (MALL) 10 ug
$150.00
RC201378L1 Lenti ORF clone of Human mal, T-cell differentiation protein-like (MALL), Myc-DDK-tagged 10 ug
$450.00
RC201378L2 Lenti ORF clone of Human mal, T-cell differentiation protein-like (MALL), mGFP tagged 10 ug
$450.00
RC201378L3 Lenti ORF clone of Human mal, T-cell differentiation protein-like (MALL), Myc-DDK-tagged 10 ug
$450.00
RC201378L4 Lenti ORF clone of Human mal, T-cell differentiation protein-like (MALL), mGFP tagged 10 ug
$450.00
SC112679 MALL (untagged)-Human mal, T-cell differentiation protein-like (MALL) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.