POLR2E (NM_002695) Human Tagged ORF Clone

SKU
RG201266
POLR2E (tGFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide E, 25kDa (POLR2E)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol POLR2E
Synonyms hRPB25; hsRPB5; RPABC1; RPB5; XAP4
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201266 representing NM_002695
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGACGAGGAGGAGACGTACCGGCTCTGGAAAATCCGCAAGACCATCATGCAGCTGTGCCACGACC
GTGGCTATCTGGTGACCCAGGACGAGCTTGACCAGACCCTGGAGGAGTTCAAAGCCCAATTTGGGGACAA
GCCGAGTGAGGGGCGGCCGCGGCGCACGGACCTCACCGTGCTGGTGGCCCACAACGATGACCCCACCGAC
CAGATGTTTGTGTTCTTTCCAGAGGAGCCCAAGGTGGGCATCAAGACCATCAAGGTGTACTGCCAGCGCA
TGCAGGAGGAGAACATCACACGGGCTCTCATCGTGGTGCAGCAGGGCATGACACCCTCCGCCAAGCAGTC
CCTGGTCGACATGGCCCCCAAGTACATCCTGGAGCAGTTTCTGCAGCAGGAGCTGCTCATCAACATCACG
GAGCACGAGCTAGTCCCTGAGCACGTCGTCATGACCAAGGAGGAGGTGACAGAGCTGCTGGCCCGATATA
AGCTCCGAGAGAACCAGCTGCCCAGGATCCAGGCGGGGGACCCTGTGGCGCGCTACTTTGGGATAAAGCG
TGGGCAGGTGGTGAAGATCATCCGGCCCAGTGAGACGGCTGGCAGGTACATCACCTACCGGCTGGTGCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201266 representing NM_002695
Red=Cloning site Green=Tags(s)

MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTD
QMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINIT
EHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002695
ORF Size 630 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002695.4
RefSeq Size 1238 bp
RefSeq ORF 633 bp
Locus ID 5434
UniProt ID P19388
Cytogenetics 19p13.3
Domains RNA_pol_Rpb5_C, RNA_pol_Rpb5_N
Protein Families Transcription Factors
Protein Pathways Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase
Summary This gene encodes the fifth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases and is present in two-fold molar excess over the other polymerase subunits. An interaction between this subunit and a hepatitis virus transactivating protein has been demonstrated, suggesting that interaction between transcriptional activators and the polymerase can occur through this subunit. A pseudogene is located on chromosome 11. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Oct 2015]
Write Your Own Review
You're reviewing:POLR2E (NM_002695) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201266 POLR2E (Myc-DDK-tagged)-Human polymerase (RNA) II (DNA directed) polypeptide E, 25kDa (POLR2E) 10 ug
$300.00
RC201266L3 Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide E, 25kDa (POLR2E), Myc-DDK-tagged 10 ug
$600.00
RC201266L4 Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide E, 25kDa (POLR2E), mGFP tagged 10 ug
$600.00
SC319449 POLR2E (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide E, 25kDa (POLR2E) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.