p23 (PTGES3) (NM_006601) Human Tagged ORF Clone

SKU
RG201254
PTGES3 (tGFP-tagged) - Human prostaglandin E synthase 3 (cytosolic) (PTGES3)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol p23
Synonyms cPGES; P23; TEBP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201254 representing NM_006601
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGCCTGCTTCTGCAAAGTGGTACGATCGAAGGGACTATGTCTTCATTGAATTTTGTGTTGAAGACA
GTAAGGATGTTAATGTAAATTTTGAAAAATCCAAACTTACATTCAGTTGTCTCGGAGGAAGTGATAATTT
TAAGCATTTAAATGAAATTGATCTTTTTCACTGTATTGATCCAAATGATTCCAAGCATAAAAGAACGGAC
AGATCAATTTTATGTTGTTTACGAAAAGGAGAATCTGGCCAGTCATGGCCAAGGTTAACAAAAGAAAGGG
CAAAGCTTAATTGGCTTAGTGTCGACTTCAATAATTGGAAAGACTGGGAAGATGATTCAGATGAAGACAT
GTCTAATTTTGATCGTTTCTCTGAGATGATGAACAACATGGGTGGTGATGAGGATGTAGATTTACCAGAA
GTAGATGGAGCAGATGATGATTCACAAGACAGTGATGATGAAAAAATGCCAGATCTGGAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201254 representing NM_006601
Red=Cloning site Green=Tags(s)

MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTD
RSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPE
VDGADDDSQDSDDEKMPDLE

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006601
ORF Size 480 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006601.7
RefSeq Size 1490 bp
RefSeq ORF 483 bp
Locus ID 10728
UniProt ID Q15185
Cytogenetics 12
Protein Families Druggable Genome, Nuclear Hormone Receptor
Summary This gene encodes an enzyme that converts prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). This protein functions as a co-chaperone with heat shock protein 90 (HSP90), localizing to response elements in DNA and disrupting transcriptional activation complexes. Alternative splicing results in multiple transcript variants. There are multiple pseudogenes of this gene on several different chromosomes. [provided by RefSeq, Feb 2016]
Write Your Own Review
You're reviewing:p23 (PTGES3) (NM_006601) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201254 PTGES3 (Myc-DDK-tagged)-Human prostaglandin E synthase 3 (cytosolic) (PTGES3) 10 ug
$150.00
RC201254L1 Lenti ORF clone of Human prostaglandin E synthase 3 (cytosolic) (PTGES3), Myc-DDK-tagged 10 ug
$450.00
RC201254L2 Lenti ORF clone of Human prostaglandin E synthase 3 (cytosolic) (PTGES3), mGFP tagged 10 ug
$450.00
RC201254L3 Lenti ORF clone of Human prostaglandin E synthase 3 (cytosolic) (PTGES3), Myc-DDK-tagged 10 ug
$450.00
RC201254L4 Lenti ORF clone of Human prostaglandin E synthase 3 (cytosolic) (PTGES3), mGFP tagged 10 ug
$450.00
SC115976 PTGES3 (untagged)-Human prostaglandin E synthase 3 (cytosolic) (PTGES3) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.