TFIIA2 (GTF2A2) (NM_004492) Human Tagged ORF Clone

SKU
RG201117
GTF2A2 (tGFP-tagged) - Human general transcription factor IIA, 2, 12kDa (GTF2A2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TFIIA2
Synonyms HsT18745; T18745; TF2A2; TFIIA; TFIIA-12; TFIIA-gamma; TFIIAS
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201117 representing NM_004492
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCATATCAGTTATACAGAAATACTACTTTGGGAAACAGTCTTCAGGAGAGCCTAGATGAGCTCATAC
AGTCTCAACAGATCACCCCCCAACTTGCCCTTCAAGTTCTACTTCAGTTTGATAAGGCTATAAATGCAGC
ACTGGCTCAGAGGGTCAGGAACAGAGTCAATTTCAGGGGCTCTCTAAATACGTACAGATTCTGCGATAAT
GTGTGGACTTTTGTACTGAATGATGTTGAATTCAGAGAGGTGACAGAACTTATTAAAGTGGATAAAGTGA
AAATTGTAGCCTGTGATGGTAAAAATACTGGCTCCAATACTACAGAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201117 representing NM_004492
Red=Cloning site Green=Tags(s)

MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDN
VWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004492
ORF Size 327 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004492.3
RefSeq Size 736 bp
RefSeq ORF 330 bp
Locus ID 2958
UniProt ID P52657
Cytogenetics 15q22.2
Domains TFIIA_gamma
Protein Families Transcription Factors
Protein Pathways Basal transcription factors
Summary Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and the general initiation factors TFIIA, TFIIB (MIM 189963), TFIID (MIM 313650), TFIIE (MIM 189962), TFIIF (MIM 189968), TFIIG/TFIIJ, and TFIIH (MIM 189972). The first step involves recognition of the TATA element by the TATA-binding subunit (TBP; MIM 600075) and may be regulated by TFIIA, a factor that interacts with both TBP and a TBP-associated factor (TAF; MIM 600475) in TFIID. TFIIA has 2 subunits (43 and 12 kD) in yeast and 3 subunits in higher eukaryotes. In HeLa extracts, it consists of a 35-kD alpha subunit and a 19-kD beta subunit encoded by the N- and C-terminal regions of GTF2A1 (MIM 600520), respectively, and a 12-kD gamma subunit encoded by GTF2A2 (DeJong et al., 1995 [PubMed 7724559]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:TFIIA2 (GTF2A2) (NM_004492) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201117 GTF2A2 (Myc-DDK-tagged)-Human general transcription factor IIA, 2, 12kDa (GTF2A2) 10 ug
$150.00
RC201117L1 Lenti ORF clone of Human general transcription factor IIA, 2, 12kDa (GTF2A2), Myc-DDK-tagged 10 ug
$450.00
RC201117L2 Lenti ORF clone of Human general transcription factor IIA, 2, 12kDa (GTF2A2), mGFP tagged 10 ug
$450.00
RC201117L3 Lenti ORF clone of Human general transcription factor IIA, 2, 12kDa (GTF2A2), Myc-DDK-tagged 10 ug
$450.00
RC201117L4 Lenti ORF clone of Human general transcription factor IIA, 2, 12kDa (GTF2A2), mGFP tagged 10 ug
$450.00
SC117338 GTF2A2 (untagged)-Human general transcription factor IIA, 2, 12kDa (GTF2A2) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.