TFIIA2 (GTF2A2) (NM_004492) Human Tagged ORF Clone
SKU
RG201117
GTF2A2 (tGFP-tagged) - Human general transcription factor IIA, 2, 12kDa (GTF2A2)
-
TrueORF®
TrueORF®
Expression-ready ORF plasmid with C-terminal tag(s)
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | TFIIA2 |
Synonyms | HsT18745; T18745; TF2A2; TFIIA; TFIIA-12; TFIIA-gamma; TFIIAS |
Vector | pCMV6-AC-GFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RG201117 representing NM_004492
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCATATCAGTTATACAGAAATACTACTTTGGGAAACAGTCTTCAGGAGAGCCTAGATGAGCTCATAC AGTCTCAACAGATCACCCCCCAACTTGCCCTTCAAGTTCTACTTCAGTTTGATAAGGCTATAAATGCAGC ACTGGCTCAGAGGGTCAGGAACAGAGTCAATTTCAGGGGCTCTCTAAATACGTACAGATTCTGCGATAAT GTGTGGACTTTTGTACTGAATGATGTTGAATTCAGAGAGGTGACAGAACTTATTAAAGTGGATAAAGTGA AAATTGTAGCCTGTGATGGTAAAAATACTGGCTCCAATACTACAGAA ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201117 representing NM_004492
Red=Cloning site Green=Tags(s) MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDN VWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE TRTRPLE - GFP Tag - V |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_004492 |
ORF Size | 327 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_004492.3 |
RefSeq Size | 736 bp |
RefSeq ORF | 330 bp |
Locus ID | 2958 |
UniProt ID | P52657 |
Cytogenetics | 15q22.2 |
Domains | TFIIA_gamma |
Protein Families | Transcription Factors |
Protein Pathways | Basal transcription factors |
Summary | Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and the general initiation factors TFIIA, TFIIB (MIM 189963), TFIID (MIM 313650), TFIIE (MIM 189962), TFIIF (MIM 189968), TFIIG/TFIIJ, and TFIIH (MIM 189972). The first step involves recognition of the TATA element by the TATA-binding subunit (TBP; MIM 600075) and may be regulated by TFIIA, a factor that interacts with both TBP and a TBP-associated factor (TAF; MIM 600475) in TFIID. TFIIA has 2 subunits (43 and 12 kD) in yeast and 3 subunits in higher eukaryotes. In HeLa extracts, it consists of a 35-kD alpha subunit and a 19-kD beta subunit encoded by the N- and C-terminal regions of GTF2A1 (MIM 600520), respectively, and a 12-kD gamma subunit encoded by GTF2A2 (DeJong et al., 1995 [PubMed 7724559]).[supplied by OMIM, Mar 2008] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC201117 | GTF2A2 (Myc-DDK-tagged)-Human general transcription factor IIA, 2, 12kDa (GTF2A2) | 10 ug |
$150.00
|
|
RC201117L1 | Lenti ORF clone of Human general transcription factor IIA, 2, 12kDa (GTF2A2), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC201117L2 | Lenti ORF clone of Human general transcription factor IIA, 2, 12kDa (GTF2A2), mGFP tagged | 10 ug |
$450.00
|
|
RC201117L3 | Lenti ORF clone of Human general transcription factor IIA, 2, 12kDa (GTF2A2), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC201117L4 | Lenti ORF clone of Human general transcription factor IIA, 2, 12kDa (GTF2A2), mGFP tagged | 10 ug |
$450.00
|
|
SC117338 | GTF2A2 (untagged)-Human general transcription factor IIA, 2, 12kDa (GTF2A2) | 10 ug |
$150.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.