POLR2D (NM_004805) Human Tagged ORF Clone

SKU
RG201116
POLR2D (tGFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide D (POLR2D)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$425.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol POLR2D
Synonyms HSRBP4; HSRPB4; RBP4; RPB4; RPB16
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201116 representing NM_004805
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGGTGGCAGCGATCCGCGGGCTGGCGACGTAGAGGAGGACGCCTCACAGCTCATCTTTCCTA
AAGAGTTTGAAACAGCTGAGACACTTCTAAATTCAGAAGTTCATATGCTTCTGGAACATCGAAAGCAGCA
GAATGAGAGTGCAGAGGACGAACAGGAGCTCTCAGAAGTCTTCATGAAAACATTAAACTACACAGCCCGT
TTCAGTCGTTTCAAAAACAGAGAGACCATTGCCAGTGTTCGTAGCTTGCTACTCCAGAAAAAGCTTCATA
AGTTTGAGTTGGCCTGTTTGGCCAACCTTTGCCCAGAGACTGCTGAGGAGTCCAAGGCTCTAATCCCAAG
CTTGGAGGGACGGTTTGAAGATGAGGAGCTGCAGCAGATTCTTGATGATATCCAGACAAAGCGCAGCTTT
CAGTAT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201116 representing NM_004805
Red=Cloning site Green=Tags(s)

MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTAR
FSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSF
QY

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004805
ORF Size 426 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004805.4
RefSeq Size 1909 bp
RefSeq ORF 429 bp
Locus ID 5433
UniProt ID O15514
Cytogenetics 2q14.3
Domains RNA_pol_Rpb4, RPOL4c
Protein Families Transcription Factors
Protein Pathways Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase
Summary This gene encodes the fourth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit is associated with the polymerase under suboptimal growth conditions and may have a stress protective role. A sequence for a ribosomal pseudogene is contained within the 3' untranslated region of the transcript from this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:POLR2D (NM_004805) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201116 POLR2D (Myc-DDK-tagged)-Human polymerase (RNA) II (DNA directed) polypeptide D (POLR2D) 10 ug
$225.00
RC201116L3 Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide D (POLR2D), Myc-DDK-tagged 10 ug
$525.00
RC201116L4 Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide D (POLR2D), mGFP tagged 10 ug
$525.00
SC117116 POLR2D (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide D (POLR2D) 10 ug
$225.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.